All documents

RSS feed for this page

Water and Wastewater CommissionApril 16, 2025

Item #07 - Emergency and Lift Station IDIQ original pdf

Thumbnail of the first page of the PDF
Page 1 of 4 pages

Item 7 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 ..Title Posting Language Recommend approval to authorize a contract for 2025 Facilities - Emergency and Lift Station – IDIQ for Austin Water with Rangeline Utility Services, LLC, in the amount of $7,000,000 for an initial term of one year with up to two one-year extension options for a total contract amount not to exceed $21,000,000. Funding: $7,000,000 is available in the Capital Budget of Austin Water. ..Body Lead Department Financial Services Department. Managing Department Austin Water. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 6100 CLMC1080 for these services. The solicitation was issued on January 6, 2025, and closed on February 13, 2025. Of the two offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm? sid=141594 . MBE/WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 5.37% MBE and 2.52% WBE participation. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: A previous contract was developed to support facility needs such as emergency response services as well as non-emergency improvements for components of the Austin Water system. That contract was approved by Council in 2014 and has been completed and fully expended. This project is the fourth sequence of contracts to deliver Emergency and Lift Station Services and this contract will be used by Austin Water Facility Engineering to address facility emergencies and maintain lift stations. Item 7 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 The work includes but is not limited to emergency on-call response, operations support, and the rehabilitation of existing facilities. The contractor will provide on-call or emergency response services to repair/replace components of the system due to maintenance, failure, etc. This is an Indefinite Delivery/Indefinite Quantity (IDIQ) contract which provides for an indefinite quantity of services for a fixed time, usually an initial term with extension options. They are commonly used when precise quantities of supplies or services, above a specified minimum, cannot be determined. IDIQ contracts help streamline the contract process and service delivery and …

Scraped at: April 12, 2025, 2:48 a.m.
Water and Wastewater CommissionApril 16, 2025

Item #08 - TWDB SWIFT Loan - Polybutylene Service Lines original pdf

Thumbnail of the first page of the PDF
Page 1 of 1 page

Item 8 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $45,000,000 as part of the TWDB’s State Water Implementation Fund for Texas (SWIFT) loan program, for Austin Water’s Polybutylene Pipe Replacement project (also known as the “Municipal Conservation Project”). Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $45,000,000 for Austin Water’s polybutylene pipe replacement project. Austin Water's waterline services replacement program was established to systematically replace water service lines—the small-diameter lines that connect water mains to customer meters—aimed at reducing water loss throughout Austin's distribution system. Polybutylene pipes tend to fail at a disproportionately high rate compared to other materials, such as copper and HDPE (high-density polyethylene). This initiative is part of Austin Water’s conservation strategy, which seeks to minimize water loss through the replacement of outdated service lines. Since 2001, Austin Water has been proactively replacing polybutylene and polyethylene services in areas of high static pressure using both internal forces and contractor resources. Under a current amended contract that Council approved on March 27, 2025, Austin Water is replacing approximately 2,200 polybutylene and polyethylene water services with pressures exceeding 105 pounds per square inch in 62 subdivisions across Austin. Construction on this current phase of replacements is currently ongoing and is projected to be completed in Fall 2025. This proposed loan from the Texas Water Development Board will be used to fund an additional phase, to replace another 10,000 polybutylene service lines. The design contract for this next phase will be brought to Council for consideration in Winter 2025.

Scraped at: April 12, 2025, 2:48 a.m.
Water and Wastewater CommissionApril 16, 2025

Item #09 - TWDB SWIFT Loan - Reclaimed Main Project original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

Item 9 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $10,000,000 as part of the TWDB’s State Water Implementation Fund for Texas (SWIFT) loan program, for Austin Water’s Travis Heights Reclaimed Water Main project (also known as the “Direct Reuse Strategy Project”). Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $10,000,000 for Austin Water’s Travis Heights Reclaimed Water Main project. It was initially submitted to the Texas Water Development Board as a “Direct Reuse Strategy”. The Travis Heights Reclaimed Water Main project aims to increase the use of reclaimed water and decrease the demand for potable water. It will accomplish this by installing 4,500 linear feet of 24-inch reclaimed water main to expand the reclaimed water distribution system in the Travis Heights neighborhood, specifically along Fairmount Avenue, Alameda Drive, East Side Drive, and Monroe Street. This project will enhance the centralized direct non-potable reuse service area and increase the number of reclaimed water users in Austin. The Travis Heights Reclaimed Water Main Project is part of a series of initiatives designed to provide more reliable service to reclaimed water customers. Currently, Austin Water's Travis Heights Reclaimed Water Main Project is in the design phase. Once completed, it will deliver reclaimed water to customers for various non-potable uses, such as irrigation, toilet flushing, and industrial applications. Austin Water anticipates bringing the related construction contract to Council for award in Winter 2025. This project will be located in Council District 9. Item: 9 ALAMEDADRSCONGRESSAVEROSEDALE TERHILLSIDEAVENICKERSONSTBROOKLYN STMUSIC LNMARIPOSADRCOLLEGE AVEMELISSA LNEVA DRACADEMYDRWOODLANDAVETRAVISHEIGHTSBLVDBRACKENRIDGESTEMONROESTLOCKHARTDRFAIRMOUNTAVEEANNIESTWJAMESSTALTAVISTAAVETHECIRCLECROCKETT STNEWTONSTMILAMPLLELANDSTDRAKEAVEEVASTWMARYSTEGIBSONSTWANNIESTEMILTONSTWMONROESTWGIBSONSTWJOHANNASTWMILTONSTRAVINEDRSUNSETLNPECANGROVERDNEWNINGAVEEASTSIDEDREMARYSTTERRACEDRPARKLNSUNNYLNBICKLERRDProject Location: 5267.075 - Travis Heights Reclaimed Water Main02905808701,160145Feet¯ReclaimedWater:Approx.4,500LFProject Limits§¨¦35§¨¦35¬«1¬«1

Scraped at: April 12, 2025, 2:48 a.m.
Water and Wastewater CommissionApril 16, 2025

Item #10 - TWDB Flood Loan - Walnut Creek WWTP Flood Wall original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

Item 10 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $65,000,000 as part of the TWDB’s Flood Infrastructure Fund (FIF) program, for Austin Water’s Walnut Creek Wastewater Treatment Plant Flood Wall project. Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $65,000,000 for Austin Water’s Walnut Creek Wastewater Treatment Plant Flood Wall project. The proposed floodwall would be to prevent encroachment of flood waters at Walnut Creek Wastewater Treatment Plant (WWTP). The flood wall would consist of approximately 5,650 linear feet of sheet pile and 1,600 linear feet of concrete wall, totaling 7,250 linear feet, ranging in height from three feet to ten feet in height. The floodwall also includes seven flood gates to allow pedestrian and vehicular ingress and egress into the plant site. The floodwall will encompass the Walnut Creek WWTP, approximately 63 acres, including the existing 75 million gallon per day (MGD) plant, existing administration and maintenance buildings, existing reclaimed facilities, the proposed 25 MGD plant and proposed wet weather facility. The Walnut Creek WWTP is one of the two major wastewater treatment plants in the City of Austin. The plant is in East Austin, was built in various stages dating back to 1977 and has undergone several expansions. The plant is currently permitted for 75 million gallons per day (MGD) (average daily flow) and a plant expansion is currently underway to increase the capacity to 100 MGD with plans to increase the capacity to 150 MGD as the ultimate plant capacity. The Walnut Creek WWTP service area includes three sewersheds defined as follows: Walnut and Little Walnut; Crosstown tunnel; and Johnny Morris. These three sewersheds effectively cover the COA from immediately north of the Colorado River to the northern limits of the COA and easterly to the plant location. The treatment of wastewater flow from these sewersheds is totally dependent upon the operation of the Walnut Creek WWTP. The plant is …

Scraped at: April 12, 2025, 2:48 a.m.
Downtown CommissionApril 16, 2025

Agenda original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

REGULAR CALLED MEETING OF THE DOWNTOWN COMMISSION Wednesday April 16, 2025, 5:30 p.m. Austin City Hall, Council Chambers, Room 1001 301 W 2nd Street Austin, Texas 78701 Some members of the Downtown Commission may be participating by videoconference. The meeting may be viewed online at: http://www.austintexas.gov/page/watch-atxn-live Public comment will be allowed in-person or remotely via telephone. Speakers may only register to speak on an item once either in-person or remotely and will be allowed up to three minutes to provide their comments. Registration no later than noon the day before the meeting is required for remote participation by register, please contact Christi Vitela at Christi.Vitela@austintexas.gov or (512) 974-2792. telephone. To CURRENT BOARD MEMBERS: Ed Ishmael, Vice Chair Peter Breton Pat Buchta David Carroll Liz Coufal Kimberly Levinson Charles Peveto Sania Shifferd Philip Wiley CALL TO ORDER AGENDA Jennifer Franklin Nkiru Gelles Amy Mok Anne Charlotte Patterson Nelly Paulina Ramírez Spencer Schumacher PUBLIC COMMUNICATION: GENERAL The first ten speakers signed up prior to the meeting being called to order will each be allowed a three-minute allotment to address their concerns regarding items not posted on the agenda. APPROVAL OF MINUTES 1. Approve the minutes of the Downtown Commission regular called meeting on March 19, 2025. STAFF BRIEFINGS 2. Staff briefing by Charles Loosen, Community Engagement Consultant, Austin Public Health and David Gray, Homeless Strategy Officer, Homeless Strategy Office, regarding an update on the work of the Homeless Strategy Office in the downtown Austin area. DISCUSSION ITEMS 3. Presentation and discussion on proposed amendments to the University Neighborhood Overlay (UNO), which includes height allowances, uses, affordability requirements, district boundaries, parking standards, and design criteria. Presentation by Alan Pani, Planner Principal, Planning Department. DISCUSSION AND ACTION ITEMS 4. Conduct officer elections for the Chair and Vice Chair. 5. Approve a Recommendation to Council regarding Cap and Stitch Initial Funding. FUTURE AGENDA ITEMS ADJOURNMENT The City of Austin is committed to compliance with the American with Disabilities Act. Reasonable modifications and equal access to communications will be provided upon request. Meeting locations are planned with wheelchair access. If requiring Sign Language Interpreters or alternative formats, please give notice at least 2 days (48 hours) before the meeting date. Please call Christi Vitela at the Office of the City Clerk, at (512) 974-2792 for additional information; TTY users’ route through Relay Texas at 711. For more information on the Downtown Commission, please contact Christi Vitela …

Scraped at: April 12, 2025, 4:34 a.m.
Downtown CommissionApril 16, 2025

Item #1 Draft Meeting Minutes March 19, 2025 original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

Downtown Commission Meeting Minutes Wednesday, March 19, 2025 DOWNTOWN COMMISSION REGULAR MEETING WEDNESDAY, MARCH 19, 2025 The Downtown Commission convened the regular meeting on Wednesday, March 19, 2025, at City Hall, 301W 2nd St, in a hybrid meeting format. COMMISSIONERS IN ATTENDANCE Ed Ishmael, Vice-Chair David Carroll Liz Coufal Kimberly Levinson Charles Peveto Sania Shifferd Philip Wiley COMMISSIONERS IN ATTENDANCE REMOTELY Jennifer Franklin Nkiru Gelles Anne-Charlotte Patterson Nelly Paulina Ramírez Spencer Schumacher CALL TO ORDER Vice Chair Ishmael called the meeting of the Downtown Commission to order at 5:31 pm. PUBLIC COMMUNICATION: GENERAL None. APPROVAL OF MINUTES 1. Approve the minutes of the Downtown Commission regular called meeting on February 19, 2025. The minutes from the meeting on February 19, 2025, were approved on Commissioner Peveto’s motion, Commissioner Levinson’s second, on a 7-0 vote. Commissioner Breton was absent. Downtown Commission Meeting Minutes Wednesday, March 19, 2025 STAFF BRIEFINGS 2. Staff briefing regarding the recent work towards renovating the Austin Convention Center. Presentation by Trisha Tatro, Director, Austin Convention Center Department. The presentation was made by Katy Zamesnik, Assistant Director, Austin Convention Center, and Riley Triggs, Capital Delivery Consultant, Capital Delivery Services Department. 3. Staff briefing regarding the Austin Historic Resource Survey by the Historic Preservation Office. Presentation by Sofia Wagner, Planner III, Planning Department. The presentation was made by Sofia Wagner, Planner III, Planning Department. DISCUSSION ITEMS Item 5 was taken up before Item 4 without objection. 5. Update from the liaison from the Urban Transportation Commission on Recommendation Number 20250304-003: Austin Core Transportation Plan and Recommendation Number 20250304-006: Austin Light Rail Draft Environmental Impact Statement. Discussed. 4. Update from the liaison from the Parks and Recreation Board on the topics discussed at the January 2025, and February 2025, board meetings. Discussed. FUTURE AGENDA ITEMS University Neighborhood Overlay Officer Elections Shared Micromobility Program Homeless Office Update Downtown Austin Plan Update Red River Cultural District ADJOURNMENT A motion to adjourn the meeting at 6:59 p.m. was approved on Commissioner Levinson’s motion, Commissioner Peveto’s second on a 7-0 vote. Commissioner Breton was absent.

Scraped at: April 12, 2025, 4:34 a.m.
Downtown CommissionApril 16, 2025

Item #3 University Neighborhood Overlay Update - Planning Department original pdf

Thumbnail of the first page of the PDF
Page 1 of 38 pages

C20-2024-010 UNO Update Downtown Commission April 16, 2025 Alan Pani, Principal Planner Content Background Process Proposed Changes Next Steps Background Subdistrict Outer West Inner West Guadalupe Dobie Background  UNO: A Brief History – Established in 2004 (Updated: 2014, 2019) – Overlay district for the West University area designed to promote high-density and pedestrian-oriented redevelopment that maintains the existing character of the area – Helped to facilitate population growth to over 28,000 residents in the West Campus area 4 City Council Resolution  Resolution No. 20240418-077 – Adopted on April 18, 2024 – Includes 29 distinct items for further investigation – Initiated updates to the Land Development Code & Building Criteria Manual – Requested programmatic updates – Land Development Code changes to be considered in Spring 2025 5 Resolution Goals  Provide quality, safe, affordable living for all, especially for students attending colleges and universities by: Increasing housing capacity, quality, and affordability Ensuring the area provides daily needs and services Supporting the implementation of light rail and mobility enhancements 6 Land Development Code Council Direction  Height limits achievable with participation in the University Neighborhood Overlay (UNO) density bonus program in alignment with the Planning Commission's recommendation to remove height limits for Inner West Campus and Dobie  Height limits that are similar to what can be achieved with participation in the ETOD overlay, at minimum  Expansion of UNO boundaries  Subdistrict boundaries that expand Inner West Campus  An appropriate step down of heights within expansion areas  Modifying development requirements to discourage above-ground parking and encourage shared parking and underground parking  Stakeholder and community engagement 7 Process How it Works  3-Step Process for Code Amendments: Initiation Development & Engagement Review & Adoption 9 Rezoning Process  To update the regulations, staff proposes to create a new zoning district that incorporates the existing overlay with requested updates  Rezoning requires notice to impacted properties and review by the Planning Commission and City Council at public hearings 10 Plan Amendment Process UNO is part of the Central Austin Combined Neighborhood Plan, an element of the Imagine Austin Comprehensive Plan Current Future Land Use Map 11 Plan Amendment Process  Mixed use land use designation allows up to 3:1 floor-to-area ratio (FAR)  High density mixed use is appropriate for areas with 3:1 FAR or greater  Staff propose updating the Central Austin Combined Neighborhood Plan to ensure …

Scraped at: April 12, 2025, 4:34 a.m.
Downtown CommissionApril 16, 2025

Item #5 Draft Recommendation to Council- Cap and Stitch Funding original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

BOARD/COMMISSION RECOMMENDATION Downtown Commission Recommendation Number_________________________: Cap and Stitch Initial Funding Recommendation: WHEREAS the Texas Department of Transportation (TxDOT)’s I-35 Capital Express Central project will lower the highway’s main lanes between Lady Bird Lake and Airport Boulevard; and WHEREAS the City of Austin has identified a once-in-a-generation opportunity to change the landscape of Central Austin through the construction of "caps" and "stitches" over the highway (“Caps and Stiches); and WHEREAS the City of Austin has undertaken the Our Future 35 Austin project which is a community-centered initiative to create public spaces along the I-35 corridor caps and stitches that will reconnect East and West Austin; and WHEREAS the Caps and Stitches, while being built and once completed, will directly impact the quality of life for those working and living in Downtown; and WHEREAS the City of Austin is in the process of developing plans for constructing the Caps and Stitches; and WHEREAS the City has identified phases of the Cap and Stitch Construction which are: • Ceasar Chavez to 4ht Street 4th Street to 7th Street • 11th Street to 12 street • 38th Street to Airport Blvd. (Northern Cap); and • WHEREAS I-35 from Lady Bird Lake to Martin Luther King Jr Boulevard marks the eastern boundary of the Downtown Commission’s jurisdiction; and WHEREAS the Downtown Commission supports the timely and efficient planning and construction of the Caps and Stitches; and WHEREAS the City of Austin is considering several funding and design options for the roadway elements of the Caps and Stitches; and WHEREAS City staff has presented funding scenarios to the City Council for consideration; and WHEREAS the Our Future 35 project has included years of stakeholder engagement and visioning for building out each full cap; and WHEREAS, the City of Austin has provided options for shortened (800’) caps along the I-35 corridor; and WHEREAS the 800’ shortened caps scenario does not support the design and vision of the Our Future 35 project; and WHEREAS neither funding scenario includes design and construction of the full-size caps envisioned in the Our Future 35 Austin project even though the intention is to someday finish the full caps; and WHEREAS: it is the considered opinion of the Downtown Commission that funding of the Our Future 35 roadway elements should include all full-size caps. NOW THEREFORE we, the Commissioners of the Austin Downtown Commission, do hereby strongly recommend and urge the Austin …

Scraped at: April 12, 2025, 4:34 a.m.
Water and Wastewater CommissionApril 16, 2025

Item #11 - Staff Presentation original pdf

Thumbnail of the first page of the PDF
Page 1 of 11 pages

Recruitment, Retention, &Training Update Israel Custodio, MLS Interim Assistant Director of ELD Water and Wastewater Commission Wednesday, April 16, 2025 Austin Water Organization Chart Current Org Chart 2 Recruitment & Retention 3 Vacancy Percentage by Fiscal Year 14.56% 14.03% 13.96% 12.78% 11.25% 10.55% 10.71% 10.32% 11.63% 12.02% 11.33% 11.40% 10.86% 11.76% 10.95% 11.09% 10.14% 9.55% 10.35% 9.99% 9.70% 10.64% 10.64% 10.21% 9.85% 9.85% 10.14% 9.56% 8.83% 8.40% 8.94% 8.58% 8.58% 8.58% Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb 2022 2023 2024 2025 16.00% 14.00% 12.00% 10.00% 8.00% 6.00% 4.00% 2.00% 0.00% 4 Current Vacancies by Age 7% 21% 1% 40% 1) Less than 3 Months 2) 3-6 Months 3) 6-12 Months 4) 1-2 Years 5) Greater than 2 years 31% 5 Positions Filled Vs. Separations 336 298 190 179 218 120 269 135 Positions Filled Seperations 95 46 2021 2022 2023 2024 2025 6 Separations by Source 2025 YTD 2025 6 18 5 18 47 2024 16 30 31 62 139 2023 18 31 2022 4 15 40 49 38 2021 7 13 31 2020 10 43 24 21 45 120 31 107 80 179 81 178 Deceased Terminated Retired Transferred Resigned 7 Training 8 Training In Action  Operational Training Division  On Boarding Training  Technical Job Skills Training  Licensure Training 9 The Future is Now 10 Questions?

Scraped at: April 14, 2025, 8:13 p.m.
Downtown CommissionApril 16, 2025

Item #2 Homeless Strategy Office Presentation original pdf

Thumbnail of the first page of the PDF
Page 1 of 13 pages

HOMELESS STRATEGY OFFICE CITY OF AUSTIN DOWNTOWN COMMISSION David Gray Homeless Strategy Officer City of Austin Est. Homeless Population: 6,300 People Exiting Homelessness: 3,000 (50% increase from 2022) Unique People Served: 24,300 (60% increase from 2022) First-Time Service Recipients: 8,400 (72% increase from 2022) Chronic Homeless Rate: 30% 2023 AUSTIN-TRAVIS COUNTY HOMELESS RESPONSE SYSTEM (HRS) DATA/METRICS HOMELESS STRATEGY OFFICE ESTABLISHED DECEMBER 2023 The Homeless Strategy Office (HSO) collaborates with public agencies, community organizations, and individuals to make homelessness rare, brief, and nonrecurring. Homeless Strategy Office Core Objectives 1. Manage the City of Austin’s homeless response resources, including 80+ contracts with various providers. 2. Create and support opportunities to produce more shelter and housing options for people experiencing homelessness. 3. Prioritize and coordinate cleanups and closures of encampments on public land. 4. Collaborate with research partners to incorporate best practices into services. 5. Proactively communicate the City of Austin’s efforts to make homelessness rare, brief, and nonrecurring. 6. Broaden the base of financial support for local initiatives and organizations. HOMELESS STRATEGY OFFICE STRATEGIES TO ADDRESS HOMELESSNESS Homeless Prevention: Activities that support households at-risk of homelessness. Street Outreach: Activities that meet the immediate needs of people living unsheltered. Public Space Management: Activities that ensure public spaces are safe, accessible, and welcoming for all community members. Diversion/Rapid Exit: Activities that immediately address the needs of someone who has recently lost their housing and become homeless. Emergency Shelters: Facilities that provide people experiencing homelessness with access to food, sleep, medical care, and safety. Rapid Rehousing (RRH): Activities that provide short- term rental assistance and case management services to help tenants stabilize in their new homes. Permanent Supportive Housing (PSH): A long-term housing model that combines affordable housing with case management and supportive services. PROGRAM SPOTLIGHT: HOUSING-FOCUSED ENCAMPMENT ASSISTANCE LINK (HEAL) Austin City Council Resolution No. 20210204-049 • The HEAL initiative compassionately closes the most unsafe encampments in our city. • Everyone residing at an encampment is offered a direct path to shelter and opportunities for stable housing. • Two emergency shelters (called “BRIDGE” shelters) are designated for HEAL. • 71% of clients who enter shelters have been homeless for 12+ months. • Half of clients leaving shelter go to a housing destinations. 31 Encampment Decommissions 1075 People Moved to Bridge Shelter AUSTIN EMERGENCY SHELTER NETWORK CITY-OWNED SHELTER LOCATIONS Shelter Name and Location 1. Austin Resource Center for the Homeless (ARCH) 130 semi-congregate beds Male …

Scraped at: April 14, 2025, 9:59 p.m.
Downtown CommissionApril 16, 2025

Item #5 Revised Draft Recommendation to Council - Cap and Stitch Initial Funding original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

BOARD/COMMISSION RECOMMENDATION Downtown Commission Recommendation Number_________________________: Cap and Stitch Initial Funding Recommendation: WHEREAS the Texas Department of Transportation (TxDOT)’s I-35 Capital Express Central project will lower the highway’s main lanes between Lady Bird Lake and Airport Boulevard; and WHEREAS the City of Austin has identified a once-in-a-generation opportunity to change the landscape of Central Austin through the construction of "caps" and "stitches" over the highway (“Caps and Stiches); and WHEREAS the City of Austin has undertaken the Our Future 35 Austin project which is a community-centered initiative to create public spaces along the I-35 corridor caps and stitches that will reconnect East and West Austin; and WHEREAS the Caps and Stitches, while being built and once completed, will directly impact the quality of life for those working and living in Downtown; and WHEREAS the City of Austin is in the process of developing plans for constructing the Caps and Stitches; and WHEREAS the City has identified phases of the Cap and Stitch Construction which are: • Ceasar Chavez to 4ht Street • 4th Street to 7th Street 11th Street to 12 street • 38th Street to Airport Blvd. (Northern Cap); and • WHEREAS I-35 from Lady Bird Lake to Martin Luther King Jr Boulevard marks the eastern boundary of the Downtown Commission’s jurisdiction; and WHEREAS the Downtown Commission supports the timely and efficient planning and construction of the Caps and Stitches; and WHEREAS the City of Austin is considering several funding and design options for the roadway elements of the Caps and Stitches; and Draft WHEREAS City staff has presented funding scenarios to the City Council for consideration; and WHEREAS the Our Future 35 project has included years of stakeholder engagement and visioning for building out each full cap; and WHEREAS, the City of Austin has provided options for shortened (800’) caps along the I-35 corridor; and WHEREAS the 800’ shortened caps scenario does not support the design and vision of the Our Future 35 project; and WHEREAS neither funding scenario includes design and construction of the full-size caps envisioned in the Our Future 35 Austin project; and WHEREAS: it is the considered opinion of the Downtown Commission that funding of the Our Future 35 roadway elements should include all full-size caps. NOW THEREFORE we, the Commissioners of the Austin Downtown Commission, do hereby strongly recommend and urge the Austin City Council to fully fund the roadway elements necessary to …

Scraped at: April 16, 2025, 5:36 p.m.
Downtown CommissionApril 16, 2025

Play video original link

Play video

Scraped at: April 17, 2025, 3:25 p.m.
Downtown CommissionApril 16, 2025

Recommendation 20250416-005 - Cap and Stitch Initial Funding original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

BOARD/COMMISSION RECOMMENDATION Downtown Commission Recommendation Number 20250416-005: Cap and Stitch Initial Funding Recommendation: WHEREAS the Texas Department of Transportation (TxDOT)’s I-35 Capital Express Central project will lower the highway’s main lanes between Lady Bird Lake and Airport Boulevard; and WHEREAS the City of Austin has identified a once-in-a-generation opportunity to change the landscape of Central Austin through the construction of "caps" and "stitches" over the highway (“Caps and Stitches); and WHEREAS the City of Austin has undertaken the Our Future 35 Austin project which is a community-centered initiative to create public spaces along the I-35 corridor caps and stitches that will reconnect East and West Austin; and WHEREAS the Caps and Stitches, while being built and once completed, will directly impact the quality of life for those working and living in Downtown; and WHEREAS the City of Austin is in the process of developing plans for constructing the Caps and Stitches; and WHEREAS the City has identified phases of the Cap and Stitch Construction which are: • Cesar Chavez to 4th Street • 4th Street to 7th Street • 11th Street to 12th Street • 38th Street to Airport Blvd. (Northern Cap); and WHEREAS I-35 from Lady Bird Lake to Martin Luther King Jr Boulevard marks the eastern boundary of the Downtown Commission’s jurisdiction; and WHEREAS the Downtown Commission supports the timely and efficient planning and construction of the Caps and Stitches; and WHEREAS the City of Austin is considering several funding and design options for the roadway elements of the Caps and Stitches; and WHEREAS City staff has presented funding scenarios to the City Council for consideration; and WHEREAS the Our Future 35 project has included years of stakeholder engagement and visioning for building out each full cap; and WHEREAS, the City of Austin has provided options for shortened (800’) caps along the I-35 corridor; and WHEREAS the 800’ shortened caps scenario does not support the design and vision of the Our Future 35 project; and WHEREAS neither funding scenario includes design and construction of the full-size caps envisioned in the Our Future 35 Austin project; and WHEREAS: it is the considered opinion of the Downtown Commission that funding of the Our Future 35 roadway elements should include all full-size caps. NOW THEREFORE we, the Commissioners of the Austin Downtown Commission, do hereby strongly recommend and urge the Austin City Council to fully fund the roadway elements necessary to …

Scraped at: April 17, 2025, 3:25 p.m.
Environmental CommissionApril 16, 2025

Play video original link

Play video

Scraped at: April 18, 2025, 1:26 a.m.
Water and Wastewater CommissionApril 16, 2025

Play video original link

Play video

Scraped at: April 18, 2025, 11:28 a.m.
Codes and Ordinances Joint CommitteeApril 16, 2025

Play audio original link

Play audio

Scraped at: April 22, 2025, 12:02 a.m.
Environmental CommissionApril 16, 2025

20250416-002: Flatz 130 Approved Recommendation original pdf

Thumbnail of the first page of the PDF
Page 1 of 1 page

ENVIRONMENTAL COMMISSION MOTION 20250416-002 Date: April 16, 2025 Subject: Flatz-130 SP-2024-0298D Location: 7400 Zekelman Blvd, Austin, TX 78724 Motion by: Mariana Krueger Seconded by: Richard Brimer WHEREAS, the Environmental Commission recognizes the applicant is requesting: • Request to vary LDC 25-8-341 to allow up to 11 feet of cut. • Request to vary LDC 25-8-342 to allow up to 16 feet of fill. • Request to vary LDC 25-8-302 to allow up to 600 SF of building on slopes over 25%, and to allow up to 3,000 SF of parking area on slopes over 15%. WHEREAS, the Environmental Commission recognizes the site is located in Decker Creek Watershed, Suburban Watershed Classification, Suburban Desired Development Zone; and WHEREAS, the Environmental Commission recognizes that Staff recommends the variance with the following conditions: • 3:1 slopes will use the 609S upland seed mix with additional shrubs and trees provided near the base of the slopes to assist with stabilization. • The natural draw adjacent to buildings 3 and 7 is designed as a sunken garden that filters runoff with a trickle channel and pollinator plantings. • The site will meet full landscape requirements as specified by code despite the site being in the ETJ, where landscape ordinance do not apply. Notably, all parking spaces will be within 50 LF radius of a shade tree. THEREFORE, the Environmental Commission recommends the variance request with the following Environmental Commission conditions: 1. Reduce parking area on slopes over 15% by 10% 2. Incorporate bird friendly design and lighting where feasible VOTE 10-0 For: Hanna Cofer, Richard Brimer, Isabella Changsut, Annie Fierro, Justin Fleury, Ashika Ganguly, Mariana Krueger, Haris Qureshi, Melinda Schiera, David Sullivan Against: None Abstain: None Recuse: None Absent: Jennifer Bristol Approved By: Elizabeth Funk, Environmental Commission Liaison

Scraped at: April 22, 2025, 2:39 p.m.
Commission on Veterans AffairsApril 16, 2025

Play audio original link

Play audio

Scraped at: April 23, 2025, 12:14 p.m.
Environmental CommissionApril 16, 2025

Approved Minutes original pdf

Thumbnail of the first page of the PDF
Page 1 of 2 pages

ENVIRONMENTAL COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, April 16, 2025 The Environmental Commission convened in a Regular meeting on Wednesday, April 16, 2025, at 6310 Wilhelmina Delco Drive in Austin, Texas. Vice Chair Cofer called the Environmental Commission Meeting to order at 6:00 p.m. Commissioners in Attendance: Hanna Cofer, Richard Brimer, Isabella Changsut, Justin Fleury, Ashika Ganguly, Annie Fierro, Mariana Krueger, Martin Luecke, Haris Qureshi Commissioners in Attendance Remotely: David Sullivan Commissioners Absent: Jennifer Bristol PUBLIC COMMUNICATION: GENERAL Stephanie Simmons, Buried power lines APPROVAL OF MINUTES 1. Approve the minutes of the Environmental Commission Regular Meeting on April 2, 2025 The minutes of the Environmental Commission Regular Meeting on April 2, 2025, were approved on Commissioner Krueger’s motion, Commissioner Brimer’s second on a 9-0 vote. Commissioner Ganguly was off the dais. Commissioner Bristol was absent. PUBLIC HEARINGS 2. Name: Flatz-130 SP-2024-0298D Applicant: Ted McConaghy (Kleinfelder) Location: 7400 Zekelman Blvd, Austin, TX 78724 Council District: Council District does not apply in Extraterritorial Jurisdiction Staff: David Michael, Environmental Review Specialist, Development Services Department, (512) 974-2263, david.michael@ausitntexas.gov Applicant request: Request to vary from a) LDC 25-8-302 to allow up to 600 SF of building on slopes over 25%, and to allow up to 3,000 SF of parking area on slopes over 15%; b) LDC 25-8-341 to allow up to 11 feet of cut, and c) LDC 25-8-342 to allow up to 16 feet of fill. 1 Staff Recommendation: Staff recommends this variance with conditions Speakers: David Michael, DSD Ted McConaghy, speaking on behalf of the applicant Arthur Walts Mike McDougal, DSD A motion to close the public hearing passed on Commissioner Krueger’s motion, Commissioner Qureshi’s second, on a 10-0 vote. Commissioner Bedford was absent. A motion to recommend Flatz-130 with conditions passed on Commissioner Krueger’s motion, Commissioner Brimer’s second, on a 10–0 vote. Commissioner Bristol was absent. DISCUSSION AND ACTION ITEMS 3. Discussion and possible action on Environmental Commission committee membership The commission nominated Commissioner Luecke as a member of the Urban Forestry Committee. FUTURE AGENDA ITEMS Commissioner Qureshi mentioned a development related to Tesla. Liz Johnston (WPD) clarified they are not within the City of Austin. Commissioner Brimer asked for an update on the request to hear about CAMPO. Elizabeth Funk (WPD) said the request was emailed and will follow up. Commissioner Changsut requested a discussion and action item regarding a planting and harvesting rare earth elements research project related to the …

Scraped at: May 9, 2025, 12:07 a.m.
Downtown CommissionApril 16, 2025

Approved Minutes original pdf

Thumbnail of the first page of the PDF
Page 1 of 3 pages

Downtown Commission Meeting Minutes Wednesday, April 16, 2025 DOWNTOWN COMMISSION REGULAR MEETING WEDNESDAY, APRIL 16, 2025 The Downtown Commission convened the regular meeting on Wednesday, April 16, 2025, at City Hall, 301W 2nd St, in a hybrid meeting format. COMMISSIONERS IN ATTENDANCE Ed Ishmael, Vice-Chair Peter Breton Pat Buchta David Carroll Kimberly Levinson Charles Peveto Philip Wiley COMMISSIONERS IN ATTENDANCE REMOTELY Liz Coufal Jennifer Franklin Anne-Charlotte Patterson Nelly Paulina Ramírez CALL TO ORDER Vice Chair Ishmael called the meeting of the Downtown Commission to order at 5:31 pm. PUBLIC COMMUNICATION: GENERAL None. APPROVAL OF MINUTES 1. Approve the minutes of the Downtown Commission regular called meeting on March 19, 2025. The minutes from the meeting on March 19, 2025, were approved on Commissioner Peveto’s motion, Commissioner Levinson’s second, on a 7-0 vote. Commissioner Coufal was off the dais. Commissioner Shifferd was absent. STAFF BRIEFINGS Downtown Commission Meeting Minutes Wednesday, April 16, 2025 2. Staff briefing by Charles Loosen, Community Engagement Consultant, Austin Public Health and David Gray, Homeless Strategy Officer, Homeless Strategy Office, regarding an update on the work of the Homeless Strategy Office in the downtown Austin area. The presentation was made by Charles Loosen, Community Engagement Consultant, Homeless Strategy Office, and David Gray, Homeless Strategy Officer, Homeless Strategy Office. DISCUSSION ITEMS 3. Presentation and discussion on proposed amendments to the University Neighborhood Overlay (UNO), which includes height allowances, uses, affordability requirements, district boundaries, parking standards, and design criteria. Presentation by Alan Pani, Planner Principal, Planning Department. The presentation was made by Alan Pani, Planner Principal, Planning Department and Paul Books, Principal Planner, Parks and Recreation Department. DISCUSSION AND ACTION ITEMS 4. Conduct officer elections for the Chair and Vice Chair. The motion to approve Commissioner Ishmael as Chair was approved on Commissioner Peveto’s motion, Commissioner Levinson’s second, on an 8-0 vote. Commissioner Shifferd was absent. The motion to approve Commissioner Levinson as Vice Chair was approved on Commissioner Peveto’s motion, Commissioner Ishmael’s second, on an 8-0 vote. Commissioner Shifferd was absent. 5. Approve a Recommendation to Council regarding Cap and Stitch Initial Funding. The motion to approve the Cap and Stitch Initial Funding Recommendation was made by Commissioner Peveto, seconded by Commissioner Levinson. A motion to amend the recommendation as follows was made by Commissioner Breton and seconded by Commissioner Levinson. The amendment was to revise “Ceaser” to “Cesar” and add a “th” after “12” on the third …

Scraped at: May 24, 2025, 1:54 a.m.