Water Management Strategy Implementation REPORT First Quarter 2025, January – March Water and Wastewater Commission May 21, 2025 Contents 2 First Quarter Summary Notes Regarding Data Water Conservation Updates Water Loss Reduction Updates Reclaimed Water and Onsite Reuse Updates Conservation Outreach Updates Water Use and GPCD Water Supply Project Updates First Quarter Summary The sustainability of Austin’s water supply is critical to the City’s future. This is the first quarterly report on implementation of water management strategies in the 2024 Water Conservation and Water Forward Plans. Austin Water has committed to this regular reporting to provide the latest information for stakeholders to understand our progress. In the first quarter of Calendar Year 2025, Austin Water initiated many bedrock tasks of water management strategies, including this new process of reporting. Notes Regarding Data Quarterly reporting of strategy implementation is a groundbreaking effort undertaken by Austin Water. Several important metrics require both explanation and development. Some metrics will be available in future quarterly reports. Quarterly Data – All quarterly data should be considered preliminary and draft, subject to adjustment and revision at the end of the year and included in the annual report. Historical Data – Where possible, 2024 quarterly metrics are included for reference with the 2025 first quarter metrics. Not all metrics have historical data. Yield of Strategies – Estimated volumetric yields from strategies are included in the Water Conservation Plan (2029 and 2034) and the Water Forward Plan (2030). Austin Water is working to identify the volumetric yields of strategies as they are being implemented and report them in future reporting. 4 Water Conservation Updates New single family residential irrigation inspections started in October 2024 3 Commercial/Institutional water audits conducted with pre-approved Bucks for Business applications Commercial water audit training: 2 staff members were certified and local utilities are working to bring the training to Central Texas WaterWise Landscape and Rainscape applications increased by 900% and 350% respectively between Q1 2024 and Q1 2025 5 Water Conservation Metrics Residential Rebate Programs Approved Rebates 45 40 35 30 25 20 15 10 5 0 6 Drought Survival Tools Irrigation Upgrades Other Residential Programs Rainwater Harvesting Rebates WaterWise Landscape WaterWise Rainscape Q1 2024 Q2 2024 Q3 2024 Q4 2024 Q1 2025 Water Conservation Metrics Commercial Rebate Programs Approved Rebates Approved Rebates 2.5 2 1.5 1 0.5 …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, May 21, 2025 The Water and Wastewater Commission convened in a regular called meeting on May 21, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Commission Members in Attendance: Chair Christopher Maxwell-Gaines, Amanda Marzullo, William Moriarty (remote), Shwetha Pandurangi, Jesse Penn, Mike Reyes, Shannon Trilli, and Vice Chair Marcela Tuñón Commission Members Absent: None Chair Christopher Maxwell-Gaines called the Water and Wastewater Commission to order at 4:04 p.m. PUBLIC COMMUNICATION: GENERAL Stuart Hersh spoke about budget funding for affordable home repair. APPROVAL OF MINUTES 1. Approval of minutes from the April 16, 2025 regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Pandurangi’s motion and Commissioner Marzullo’s second on an 8-0 vote with three vacancies. DISCUSSION AND ACTION 2. Recommend approval to authorize an amendment to the 2021 Facilities - Large Facilities Indefinite Delivery/Indefinite Quantity contract for Austin Water with HEI Civil LLC, to increase the amount by $3,750,000, for a revised total contract amount not to exceed $18,750,000. Funding: $3,750,000 is available in the Capital Budget of Austin Water. Recommended on Commissioner Marzullo’s motion and Vice Chair Tuñón’s second on an 8-0 vote with three vacancies. 3. Recommend approval to authorize a contract for construction services for the North Austin CIPP Wastewater Renewal Project for Capital Delivery Services with Insituform Technologies, LLC in the amount of $2,772,892 plus a $277,290 contingency for a total contract amount not to exceed $3,050,182. Funding: $3,050,182 is available in the Capital Budget of Austin Water. Recommended on Commissioner Marzullo’s motion and Vice Chair Tuñón’s second on an 8-0 vote with three vacancies. 4. Recommend approval to authorize a contract for construction services for the East Allandale White Rock Neighborhood Water and Wastewater System Renewal – Rebid Project for Capital Delivery Services with Facilities Rehabilitation, Inc., in the amount of $4,799,250, plus a $479,925 contingency, for a total contract amount not to exceed $5,279,175. Funding: $5,279,175 is available in the Capital Budget of Austin Water. Recommended on Commissioner Pandurangi’s motion and Vice Chair Tuñón’s second on a 7-0 vote with Commissioner Penn recusing and three vacancies. Page 1 of 4 5. Recommend approval to authorize an amendment to the contract for engineering services for the McNeil Drive Water Transmission Main Project with Black & Veatch Corporation, in the amount of $5,000,000., for a revised total contract amount …
Regular Meeting of the Water and Wastewater Commission April 16, 2025 — 4:00 pm Austin Water Headquarters Waller Creek Center 625 East 10th Street, Austin Texas Some members may be participating by videoconference. The meeting may be viewed online at: http://www.austintexas.gov/page/watch-atxn-live For more information go to: http://www.austintexas.gov/wwc Public comment will be allowed in-person or remotely by telephone. Speakers may only register to speak on an item once either in-person or remotely and will be allowed up to three minutes to provide their comments. Registration no later than noon the day before the meeting is required for remote participation. To register, call or email the board liaison Heather Cooke at 512-972-0083 or Heather.Cooke@austintexas.gov. To register to speak in person, people must sign up at least ten minutes before the meeting is called to order. Commissioners: William Moriarty (Mayor) Jesse Penn (District 1) Alex Navarro (District 2) Amanda Marzullo (District 3) Mike Reyes, (District 4) Vacant (District 5) Shwetha Pandurangi (District 6) Judy Musgrove (District 7) Christopher Maxwell-Gaines, Vice Chair (District 8) Marcela Tuñón (District 9) Susan Turrieta, Chair (District 10) CALL TO ORDER PUBLIC COMMUNICATION: GENERAL APPROVAL OF MINUTES 1. Approval of minutes from the February 19, 2025 regular meeting of the Water and Wastewater Commission. DISCUSSION AND ACTION 2. Recommend approval to authorize an amendment to the contract for engineering services for the Davis Water Treatment Plant (WTP) Supervisory Control and Data Acquisition (SCADA) Improvements project Project with Harutunian Engineering, Inc., in the amount of $2,882,682, for a revised total contract amount not to exceed $4,382,682. 3. Recommend approval to authorize a contract for VXSmart utility billing customer service portal for Austin Water with Vertex U.S. Holdings, Inc. d/b/a VertexOne Software LLC or Watersmart Software Inc., for an initial term of two years and eight months with up to two one-year extension options in an amount not to exceed $1,375,000. Funding: $687,500 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. The City of Austin is committed to compliance with the American with Disabilities Act. Reasonable modifications and equal access to communications will be provided upon request. Meeting locations are planned with wheelchair access. If requiring Sign Language Interpreters or alternative formats, please give notice at least 2 days (48 hours) before the meeting date. Please call Heather Cooke at Austin Water, 512-972-0083 for additional information; TTY users’ route through Relay Texas at 711. For more information …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, February 19, 2025 The Water and Wastewater Commission convened in a regular called meeting on February 19, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Chair Turrieta called the Water and Wastewater Commission to order at 4:02 p.m. Commission Members in Attendance: Chair Susan Turrieta, Vice Chair Christopher Maxwell-Gaines, Judy Musgrove (remote), Mike Reyes, Marcela Tuñón Sion, Amanda Marzullo (remote), Alex Navarro, William Moriarty, Jesse Penn Commission Members Absent: Shwetha Pandurangi PUBLIC COMMUNICATION: GENERAL There were no registered public speakers APPROVAL OF MINUTES 1. Approval of minutes from the January 15, 2025, regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Moriarty’s motion and Commissioner Maxwell-Gaines’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. DISCUSSION AND ACTION 2. Recommend approval to authorize a contract for construction services for the 2020 Bond Substandard Streets Ross Road North with DeNucci Constructors, LLC, in the amount of $29,650,594.00 plus a $2,965,059.40 contingency for a total contract amount not to exceed $32,615,653.40. Funding in the amount of $29,669,890.33 is available in the Capital Budget of the Transportation and Public Works Department and Funding in the amount of $2,945,763.07 is available in the Capital Budget of Austin Water. Recommended on Commissioner Tuñón Sion’s motion and Commissioner Reyes’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. 3. Recommend approval of an ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Funding: This item has no fiscal impact. Recommended on Commissioner Maxwell-Gaines’ motion and Commissioner Moriarty’s second on a 9-0 vote with Commissioner Pandurangi absent. STAFF BRIEFINGS 4. Staff briefing on proposed ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize an alternative wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Supervising Engineer Katherine Jashinski provided a briefing and answered questions from Commissioners 5. Staff briefing on My ATX Water program implementation update. Assistant Director Randi Jenkins provided a briefing and answered questions from Commissioners COMMITTEE UPDATES 6. Update from the Austin Integrated Water Resource Planning Community Task Force meeting regarding Water Forward Plan implementation – Commissioner William Moriarty provided an update 7. Update …
Item 2 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 Posting Language ..Title Recommend approval to authorize an amendment to the contract for engineering services for the Davis Water Treatment Plant Supervisory Control and Data Acquisition Improvements Project with Harutunian Engineering, Inc., in the amount of $2,882,682, for a revised total contract amount not to exceed $4,382,682. Funding: $4,382,682 is available in the Austin Water Capital Budget. ..Body Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: Contract Amendment. MBE / WBE: This contract was awarded in compliance with City Code 2-9A (Minority-Owned and Women-Owned Business Enterprise Procurement Program). Current participation to date is 7.95% MBE and 92.05% WBE. Prior Council Action: January 23, 2020 – Council approved a contract for engineering services with Harutunian Engineering, Inc., for the Davis WTP Supervisory Control and Data Acquisition Improvements project. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The City utilizes surface water resources from impoundments of the Colorado River for its potable water supply. Austin Water operates three existing Water Treatment Plants, which are Ullrich, Davis, and Handcox. The Davis Plant has been in service since 1954 and has a rated treatment capacity of 118 million gallons per day (MGD). The Davis Water Treatment Plant’s Supervisory Control and Data Acquisition equipment and network infrastructure are essential to the operation of the facility. The existing equipment has exceeded its service life and is now obsolete, no longer supported by the manufacturers, and difficult to maintain. This equipment needs to be replaced and upgraded to maintain reliability. This amendment will provide construction phase engineering services including reviewing project submittals and construction documentation, developing control narratives, providing PLC and top-end programming, testing services and developing record drawings. AUTHORIZATION HISTORY Item 2 DATE DESCRIPTION AMOUNT $1,500,000.00 $2,882,682.00 $4,382,682.00 Total Contract Authorization 01/23/2020 03/27/2025 Proposed (Council) – Construction Phase Engineering Services (Council) – Preliminary and Design Engineering Services CONTRACT HISTORY AMOUNT DATE DESCRIPTION $115,708.88 $1,093,893.51 $80,525.08 $2,882,682.00 $4,172,809.47 Total Contract History 04/30/2020 Preliminary Engineering Services 09/29/2021 SA #1 – Design Engineering Services 03/18/2024 SA #2 – Additional Design Engineering Services Proposed SA #3 – Construction Phase Engineering Services City of Austin Council Meeting Backup Date: April 24, 2025 File ID: 25-0344 Page 1 of 1 Item 2 M/WBE Summary Participation goals stated in the original approved …
Item 3 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 Posting Language ..Title Recommend approval to authorize a contract for VXSmart utility billing customer service portal for Austin Water with Vertex U.S. Holdings, Inc. d/b/a VertexOne Software LLC or Watersmart Software Inc., for an initial term of two years and eight months with up to two one-year extension options in an amount not to exceed $1,375,000. Funding: $687,500 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. ..Body Lead Department Financial Services Department. Client Department(s) Austin Water. Purchasing Language: Sole Source. MBE/WBE: Sole source contracts are exempt from the City Code Chapter 2-9B (Minority-Owned and Women-Owned Business Enterprise Procurement Program); therefore, no subcontracting goals were established. Council Committee, Boards and Commission Action: April 16, 2025 - To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This contract will provide software maintenance and support for VertexOne VXSmart utility billing customer service portal. The portal alerts customers when unusual water consumption occurs due to water leaks, high water usage, and also predicts future water bills based on current water usage. Austin Water (AW) relies on VXSmart to provide their utility customers with a portal that provides water usage alerts, notifications, historical water usage billing history, and emergency messaging. Since the installation of this system in 2020, AW has sent over 5.5 million messages which have been read by nearly 70 percent of its customers. These alerts have helped to reduce water waste by over 500 million gallons each calendar year in 2023 and 2024. Vertex U.S. Holdings, Inc. d/b/a VertexOne Software LLC or Watersmart Software Inc. is the manufacturer and sole source contractor for VXSmart. AW is unable to procure this software as a service from any other supplier. This contract replaces an existing contract expiring on April 30, 2025. The recommended contractor is the current provider for these services. If this contract is not approved, AW will lose the ability to send water usage alerts and communications to utility customers.
Item 4 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 ..Title Posting Language Recommend approval to authorize a contract for construction services for the Garden Villa Lane Water & Wastewater Pipeline Renewal project for Capital Delivery Services with DeNucci Constructors, LLC, in the amount of $8,426,181 plus a $842,619 contingency for a total contract amount not to exceed $9,268,800. Funding: $5,440,931 is available in Austin Water’s Capital Budget and $3,827,870 is available in the Watershed Protection Department’s Capital Budget. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 6100 CLMC1025 for these services. The solicitation was issued December 9, 2024, and closed February 6, 2025. Of the six offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm? sid=140140 . MBE/WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) through the achievements of Good Faith Efforts with 7.17% MBE and 0.83% WBE participation. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The Garden Villa Lane Water and Wastewater Pipeline Renewal project is a part of the Renewing Austin Program, which is an ongoing effort to replace and upgrade deteriorated and aging water mains with a documented history of multiple breaks, that are in poor condition, and impact service delivery. The program also coordinates and includes wastewater lines in poor condition and in need of replacement within the project area. Additionally, through a partnership with the Watershed Protection Department (WPD), the project also includes the replacement of existing storm drainpipes to mitigate aging infrastructure and to reduce localized flooding risks. The Garden Villa Lane Water and Wastewater Pipeline Renewal project consists of repairing and replacing existing water and wastewater mains located within Barton Skyway to Cardinal Lane, Garden Villa Court, and Cardinal Lane from 5th Street to Locke Lane. Water system renewal includes approximately 143 linear feet (LF) of 6-inch, 618 LF of 8-inch, and 2,446 LF of 12-inch main along with service lines to individual properties and associated appurtenances. Wastewater system renewal includes approximately 1,825 LF of 8- inch main …
Item 5 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 Posting Language ..Title Recommend approval to authorize a contract for construction services for the Sinclair Avenue Water and Wastewater Pipeline Renewal project for Capital Delivery Services with Facilities Rehabilitation Inc., in the amount of $1,042,210 plus a $104,221 contingency for a total contract amount not to exceed $1,146,431. Funding: $1,146,431 is available in Austin Water Capital Budget. ..Body Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 6100 CLMC1094 for these construction services. The solicitation was issued on November 14, 2024, and closed on January 23, 2025. Of the four offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=141943 . MBE/WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 99.33% MBE and 0.67% WBE participation. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The Sinclair Avenue Water and Wastewater Pipeline Renewal project is part of the Renewing Austin Program, which is an ongoing effort to replace and upgrade deteriorated and aging water mains with a documented history of multiple breaks that impact service delivery, including wastewater lines in poor condition within the project area that need replacement. The Sinclair Avenue Water and Wastewater Pipeline Renewal project consists of repairing and replacing existing water and wastewater mains located within Sinclair Ave between 42nd and 44th Streets. Water system renewal includes approximately 810 linear feet of 8-inch main along with service lines to individual properties within associated right of way. Wastewater system renewal includes approximately 895 linear feet of 8-inch main, manholes, and service lines to individual properties. Installation of approximately 150 linear feet of 18” storm drain and equipment is also included. Item 5 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 Due to the potential for encountering unknown subsurface conditions, a 10% contingency in funding has been included to allow for the expeditious processing of any change orders to cover any unforeseen construction costs associated with the project. The project will …
Item 6 Water & Wastewater Commission: April 16, 2025 Council: April 24, 2025 Posting Language ..Title Recommend approval to conduct a public hearing and consider an ordinance regarding Undine, LLC’s proposal to increase water and wastewater rates for its customers located in the City’s corporate limits in the area known as Greenshores on Lake Austin. Funding: This item has no fiscal impact. ..De Lead Department Austin Water. Fiscal Note This item has no fiscal impact. Prior Council Action: November 8, 2012 – Council approved Ordinance No. 20121108-004 suspending water and wastewater rates proposed by PK-RE Development Company, Inc. on a 7-0 vote. May 2, 2024 – Council approved Ordinance No. 20240502-007 suspending an increase in water and wastewater rates proposed by Undine, LLC on an 11-0 vote. May 30, 2024 – Council set a public hearing to be held on July 18, 2024, to receive comment on the City’s recommendations regarding Undine LLC’s proposed water and wastewater rates. July 18, 2024 – Council approved Ordinance No. 20240718-115, approved water requested rates and denied wastewater requested rate changes. January 30, 2025 – Council approved Ordinance No. 20250130-005 suspending an increase in water and wastewater rates proposed by Undine, LLC. For More Information: Inquiries should be directed to Austin Water Chief Administrative Officer Heather Cooke, 512-972-0083 or Heather.Cooke@austintexas.gov. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: Undine, LLC (Undine), an investor-owned utility with customers in the area known as Greenshores on Lake Austin, filed a Statement of Intent to Change Rates to increase water and wastewater rates for its Greenshores customers. Of Undine’s affected 230 water customers and 177 wastewater customers, only a few are within Austin’s corporate limits. The remaining customers’ rates fall within the regulatory jurisdiction of the Public Utility Commission of Texas (PUCT). Under Texas Water Code Chapter 13, Council is the regulatory authority with exclusive original jurisdiction to review rates charged to water and wastewater customers within the City’s corporate limits served by non-City utilities. The Council has authority to determine whether the rates, as they affect City residents, are just and reasonable and, that in all other respects, meet State and local law. City Code Chapter 15-4 sets out the City’s process for reviewing non-City utility rate filings and requires the determination to be made in a public hearing. As also required by …
Item 7 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 ..Title Posting Language Recommend approval to authorize a contract for 2025 Facilities - Emergency and Lift Station – IDIQ for Austin Water with Rangeline Utility Services, LLC, in the amount of $7,000,000 for an initial term of one year with up to two one-year extension options for a total contract amount not to exceed $21,000,000. Funding: $7,000,000 is available in the Capital Budget of Austin Water. ..Body Lead Department Financial Services Department. Managing Department Austin Water. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 6100 CLMC1080 for these services. The solicitation was issued on January 6, 2025, and closed on February 13, 2025. Of the two offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm? sid=141594 . MBE/WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 5.37% MBE and 2.52% WBE participation. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: A previous contract was developed to support facility needs such as emergency response services as well as non-emergency improvements for components of the Austin Water system. That contract was approved by Council in 2014 and has been completed and fully expended. This project is the fourth sequence of contracts to deliver Emergency and Lift Station Services and this contract will be used by Austin Water Facility Engineering to address facility emergencies and maintain lift stations. Item 7 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 The work includes but is not limited to emergency on-call response, operations support, and the rehabilitation of existing facilities. The contractor will provide on-call or emergency response services to repair/replace components of the system due to maintenance, failure, etc. This is an Indefinite Delivery/Indefinite Quantity (IDIQ) contract which provides for an indefinite quantity of services for a fixed time, usually an initial term with extension options. They are commonly used when precise quantities of supplies or services, above a specified minimum, cannot be determined. IDIQ contracts help streamline the contract process and service delivery and …
Item 8 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $45,000,000 as part of the TWDB’s State Water Implementation Fund for Texas (SWIFT) loan program, for Austin Water’s Polybutylene Pipe Replacement project (also known as the “Municipal Conservation Project”). Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $45,000,000 for Austin Water’s polybutylene pipe replacement project. Austin Water's waterline services replacement program was established to systematically replace water service lines—the small-diameter lines that connect water mains to customer meters—aimed at reducing water loss throughout Austin's distribution system. Polybutylene pipes tend to fail at a disproportionately high rate compared to other materials, such as copper and HDPE (high-density polyethylene). This initiative is part of Austin Water’s conservation strategy, which seeks to minimize water loss through the replacement of outdated service lines. Since 2001, Austin Water has been proactively replacing polybutylene and polyethylene services in areas of high static pressure using both internal forces and contractor resources. Under a current amended contract that Council approved on March 27, 2025, Austin Water is replacing approximately 2,200 polybutylene and polyethylene water services with pressures exceeding 105 pounds per square inch in 62 subdivisions across Austin. Construction on this current phase of replacements is currently ongoing and is projected to be completed in Fall 2025. This proposed loan from the Texas Water Development Board will be used to fund an additional phase, to replace another 10,000 polybutylene service lines. The design contract for this next phase will be brought to Council for consideration in Winter 2025.
Item 9 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $10,000,000 as part of the TWDB’s State Water Implementation Fund for Texas (SWIFT) loan program, for Austin Water’s Travis Heights Reclaimed Water Main project (also known as the “Direct Reuse Strategy Project”). Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $10,000,000 for Austin Water’s Travis Heights Reclaimed Water Main project. It was initially submitted to the Texas Water Development Board as a “Direct Reuse Strategy”. The Travis Heights Reclaimed Water Main project aims to increase the use of reclaimed water and decrease the demand for potable water. It will accomplish this by installing 4,500 linear feet of 24-inch reclaimed water main to expand the reclaimed water distribution system in the Travis Heights neighborhood, specifically along Fairmount Avenue, Alameda Drive, East Side Drive, and Monroe Street. This project will enhance the centralized direct non-potable reuse service area and increase the number of reclaimed water users in Austin. The Travis Heights Reclaimed Water Main Project is part of a series of initiatives designed to provide more reliable service to reclaimed water customers. Currently, Austin Water's Travis Heights Reclaimed Water Main Project is in the design phase. Once completed, it will deliver reclaimed water to customers for various non-potable uses, such as irrigation, toilet flushing, and industrial applications. Austin Water anticipates bringing the related construction contract to Council for award in Winter 2025. This project will be located in Council District 9. Item: 9 ALAMEDADRSCONGRESSAVEROSEDALE TERHILLSIDEAVENICKERSONSTBROOKLYN STMUSIC LNMARIPOSADRCOLLEGE AVEMELISSA LNEVA DRACADEMYDRWOODLANDAVETRAVISHEIGHTSBLVDBRACKENRIDGESTEMONROESTLOCKHARTDRFAIRMOUNTAVEEANNIESTWJAMESSTALTAVISTAAVETHECIRCLECROCKETT STNEWTONSTMILAMPLLELANDSTDRAKEAVEEVASTWMARYSTEGIBSONSTWANNIESTEMILTONSTWMONROESTWGIBSONSTWJOHANNASTWMILTONSTRAVINEDRSUNSETLNPECANGROVERDNEWNINGAVEEASTSIDEDREMARYSTTERRACEDRPARKLNSUNNYLNBICKLERRDProject Location: 5267.075 - Travis Heights Reclaimed Water Main02905808701,160145Feet¯ReclaimedWater:Approx.4,500LFProject Limits§¨¦35§¨¦35¬«1¬«1
Item 10 Water & Wastewater Commission: April 16, 2025 Council: May 8, 2025 Posting Language ..Title Recommend approval of a resolution authorizing the City Manager to apply for funding from the Texas Water Development Board (TWDB) for a low-interest loan in the amount not to exceed $65,000,000 as part of the TWDB’s Flood Infrastructure Fund (FIF) program, for Austin Water’s Walnut Creek Wastewater Treatment Plant Flood Wall project. Funding is contingent upon available funding in future budgets. ..De Lead Department Austin Water. Council Committee, Boards and Commission Action: April 16, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This action will authorize Austin Water to apply for a low-interest loan from the Texas Water Development Board (TWDB), not to exceed $65,000,000 for Austin Water’s Walnut Creek Wastewater Treatment Plant Flood Wall project. The proposed floodwall would be to prevent encroachment of flood waters at Walnut Creek Wastewater Treatment Plant (WWTP). The flood wall would consist of approximately 5,650 linear feet of sheet pile and 1,600 linear feet of concrete wall, totaling 7,250 linear feet, ranging in height from three feet to ten feet in height. The floodwall also includes seven flood gates to allow pedestrian and vehicular ingress and egress into the plant site. The floodwall will encompass the Walnut Creek WWTP, approximately 63 acres, including the existing 75 million gallon per day (MGD) plant, existing administration and maintenance buildings, existing reclaimed facilities, the proposed 25 MGD plant and proposed wet weather facility. The Walnut Creek WWTP is one of the two major wastewater treatment plants in the City of Austin. The plant is in East Austin, was built in various stages dating back to 1977 and has undergone several expansions. The plant is currently permitted for 75 million gallons per day (MGD) (average daily flow) and a plant expansion is currently underway to increase the capacity to 100 MGD with plans to increase the capacity to 150 MGD as the ultimate plant capacity. The Walnut Creek WWTP service area includes three sewersheds defined as follows: Walnut and Little Walnut; Crosstown tunnel; and Johnny Morris. These three sewersheds effectively cover the COA from immediately north of the Colorado River to the northern limits of the COA and easterly to the plant location. The treatment of wastewater flow from these sewersheds is totally dependent upon the operation of the Walnut Creek WWTP. The plant is …
Recruitment, Retention, &Training Update Israel Custodio, MLS Interim Assistant Director of ELD Water and Wastewater Commission Wednesday, April 16, 2025 Austin Water Organization Chart Current Org Chart 2 Recruitment & Retention 3 Vacancy Percentage by Fiscal Year 14.56% 14.03% 13.96% 12.78% 11.25% 10.55% 10.71% 10.32% 11.63% 12.02% 11.33% 11.40% 10.86% 11.76% 10.95% 11.09% 10.14% 9.55% 10.35% 9.99% 9.70% 10.64% 10.64% 10.21% 9.85% 9.85% 10.14% 9.56% 8.83% 8.40% 8.94% 8.58% 8.58% 8.58% Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb 2022 2023 2024 2025 16.00% 14.00% 12.00% 10.00% 8.00% 6.00% 4.00% 2.00% 0.00% 4 Current Vacancies by Age 7% 21% 1% 40% 1) Less than 3 Months 2) 3-6 Months 3) 6-12 Months 4) 1-2 Years 5) Greater than 2 years 31% 5 Positions Filled Vs. Separations 336 298 190 179 218 120 269 135 Positions Filled Seperations 95 46 2021 2022 2023 2024 2025 6 Separations by Source 2025 YTD 2025 6 18 5 18 47 2024 16 30 31 62 139 2023 18 31 2022 4 15 40 49 38 2021 7 13 31 2020 10 43 24 21 45 120 31 107 80 179 81 178 Deceased Terminated Retired Transferred Resigned 7 Training 8 Training In Action Operational Training Division On Boarding Training Technical Job Skills Training Licensure Training 9 The Future is Now 10 Questions?
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, April 16, 2025 The Water and Wastewater Commission convened in a regular called meeting on April 16, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Vice Chair Christopher Maxwell-Gaines called the Water and Wastewater Commission to order at 4:04 p.m. Commission Members in Attendance: Chair Susan Turrieta (remote), Vice Chair Christopher Maxwell-Gaines (presided in person as Chair), Mike Reyes, Marcela Tuñón, Alex Navarro (remote), William Moriarty (remote), Shwetha Pandurangi Commission Members Absent: Amanda Marzullo, Judy Musgrove, Jesse Penn PUBLIC COMMUNICATION: GENERAL There were no registered public speakers APPROVAL OF MINUTES 1. Approval of minutes from the February 19, 2025, regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Tuñón’s motion and Commissioner Pandurangi’s second on a 7-0 vote with Commissioners Marzullo, Musgrove, and Penn absent. DISCUSSION AND ACTION 2. Recommend approval to authorize an amendment to the contract for engineering services for the Davis Water Treatment Plant (WTP) Supervisory Control and Data Acquisition (SCADA) Improvements project Project with Harutunian Engineering, Inc., in the amount of $2,882,682, for a revised total contract amount not to exceed $4,382,682. Recommended on Commissioner Turrieta’s motion and Commissioner Tuñón’s second on a 7-0 vote with Commissioners Marzullo, Musgrove, and Penn absent. 3. Recommend approval to authorize a contract for VXSmart utility billing customer service portal for Austin Water with Vertex U.S. Holdings, Inc. d/b/a VertexOne Software LLC or Watersmart Software Inc., for an initial term of two years and eight months with up to two one-year extension options in an amount not to exceed $1,375,000. Funding: $687,500 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. Recommended on Commissioner Turrieta’s motion and Commissioner Tuñón’s second on a 7-0 vote with Commissioners Marzullo, Musgrove, and Penn absent. 4. Recommend approval to authorize a contract for construction services for the Garden Villa Lane Water & Wastewater Pipeline Renewal project for Capital Delivery Services with DeNucci Constructors, LLC, in the amount of $8,426,181 plus a $842,619 contingency for a total contract amount not to exceed $9,268,800. Funding: $5,440,931 is available in Austin Water’s Capital Budget and $3,827,870 is available in the Watershed Protection Department’s Capital Budget. Recommended on Commissioner Turrieta’s motion and Commissioner Tuñón’s second on a 7-0 vote with Commissioners Marzullo, Musgrove, and Penn absent. 5. Recommend approval to authorize a contract for construction services for the …
Regular Meeting of the Water and Wastewater Commission March 12, 2025 — 4:00 pm Austin Water Headquarters Waller Creek Center 625 East 10th Street, Austin Texas Some members may be participating by videoconference. The meeting may be viewed online at: http://www.austintexas.gov/page/watch-atxn-live For more information go to: http://www.austintexas.gov/wwc Public comment will be allowed in-person or remotely by telephone. Speakers may only register to speak on an item once either in-person or remotely and will be allowed up to three minutes to provide their comments. Registration no later than noon the day before the meeting is required for remote participation. To register, call or email the board liaison Heather Cooke at 512-972-0083 or Heather.Cooke@austintexas.gov . To register to speak in person, people must sign up at least ten minutes before the meeting is called to order. Mike Reyes, (District 4) Vacant (District 5) Shwetha Pandurangi (District 6) Judy Musgrove (District 7) Christopher Maxwell-Gaines, Vice Chair (District 8) Marcela Tuñón Sion (District 9) Susan Turrieta, Chair (District 10) Commissioners: William Moriarty (Mayor) Jesse Penn (District 1) Alex Navarro (District 2) Amanda Marzullo (District 3) CALL TO ORDER PUBLIC COMMUNICATION: GENERAL APPROVAL OF MINUTES DISCUSSION AND ACTION 1. Approval of minutes from the February 19, 2025 regular meeting of the Water and Wastewater Commission. 2. Recommend approval of an ordinance repealing and replacing City Code Chapter 15-1 (Cross-Connection Regulations) to address changes to the nationally recognized plumbing codes, current Texas Commission on Environmental Quality (TCEQ) regulations and the expanded use of alternate water sources. Funding: This item has no fiscal impact. 3. Recommend approval to authorize a contract for brush clearing on water quality protection lands managed by Austin Water for Austin Water with Summitt Forests, Inc., for an initial term of three years with up to two one-year extension options, for a total contract amount not to exceed $1,750,000. Funding: $175,000 is available in Austin Water’s Operating Budget. Funding for the remaining contract term is contingent upon available funding in future budgets. The City of Austin is committed to compliance with the American with Disabilities Act. Reasonable modifications and equal access to communications will be provided upon request. Meeting locations are planned with wheelchair access. If requiring Sign Language Interpreters or alternative formats, please give notice at least 2 days (48 hours) before the meeting date. Please call Heather Cooke at Austin Water, 512-972-0083 for additional information; TTY users’ route through Relay Texas …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, February 19, 2025 The Water and Wastewater Commission convened in a regular called meeting on February 19, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Chair Turrieta called the Water and Wastewater Commission to order at 4:02 p.m. Commission Members in Attendance: Chair Susan Turrieta, Vice Chair Christopher Maxwell-Gaines, Judy Musgrove (remote), Mike Reyes, Marcela Tuñón Sion, Amanda Marzullo (remote), Alex Navarro, William Moriarty, Jesse Penn Commission Members Absent: Shwetha Pandurangi PUBLIC COMMUNICATION: GENERAL There were no registered public speakers APPROVAL OF MINUTES 1. Approval of minutes from the January 15, 2025, regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Moriarty’s motion and Commissioner Maxwell-Gaines’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. DISCUSSION AND ACTION 2. Recommend approval to authorize a contract for construction services for the 2020 Bond Substandard Streets Ross Road North with DeNucci Constructors, LLC, in the amount of $29,650,594.00 plus a $2,965,059.40 contingency for a total contract amount not to exceed $32,615,653.40. Funding in the amount of $29,669,890.33 is available in the Capital Budget of the Transportation and Public Works Department and Funding in the amount of $2,945,763.07 is available in the Capital Budget of Austin Water. Recommended on Commissioner Tuñón Sion’s motion and Commissioner Reyes’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. 3. Recommend approval of an ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Funding: This item has no fiscal impact. Recommended on Commissioner Maxwell-Gaines’ motion and Commissioner Moriarty’s second on a 9-0 vote with Commissioner Pandurangi absent. STAFF BRIEFINGS 4. Staff briefing on proposed ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize an alternative wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Supervising Engineer Katherine Jashinski provided a briefing and answered questions from Commissioners 5. Staff briefing on My ATX Water program implementation update. Assistant Director Randi Jenkins provided a briefing and answered questions from Commissioners COMMITTEE UPDATES 6. Update from the Austin Integrated Water Resource Planning Community Task Force meeting regarding Water Forward Plan implementation – Commissioner William Moriarty provided an update 7. Update …
..Body Item 10 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval to negotiate and execute a contract for engineering services for the Country Club Creek Wastewater Improvements Project, for Austin Water and the Watershed Protection Department, with HDR Engineering, Inc., in an amount not to exceed $3,200,000. Funding: $2,144,000 is available in Austin Water’s Capital Budget. $1,056,000 is available in Watershed Protection Department’s Capital Budget. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued a Request for Qualifications RFQS 6100 CLMP378 for these services. The solicitation was issued on October 21, 2024, and closed on December 3, 2024. Of the five responses received, the recommended contractor submitted the best evaluated response. A complete solicitation package, including a log of responses received, is available for viewing on the City’s Financial Services website, Austin Finance Online. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=140884. MBE / WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 10.09% MBE and 3.73% WBE participation. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: Austin Water’s wastewater collection system is fundamental for the conveyance of wastewater to Austin Water’s wastewater treatment plants. Austin Water’s wastewater collection system is a large and complex system, consisting of approximately 3,000 miles of wastewater mains and serves approximately one million customers. Due to deterioration from the harsh conditions of the wastewater environment, wastewater collection system assets require ongoing repair and replacement in order to prevent sanitary sewer overflows . The Country Club Creek Wastewater Improvements Project will provide replacement, relocation, and enhancement of wastewater and water infrastructure. In addition, this project will include erosion repair, stormwater control measures, adding two public trails, and stream restoration in Country Club Creek. The wastewater portion of the project includes the replacement of approximately 5,000 linear feet of existing 8-inch to 24-inch gravity wastewater pipe from Metcalfe Road to South Pleasant Valley Road with a new 18- inch to 30-inch diameter pipe. The water line portion of the project is to replace approximately 1,000 linear feet of an existing 6-inch water main that crosses Country Club Creek along Metcalfe Road and install a new 12-inch line along Metcalfe. …
..De Item 2 Water & Wastewater Commission: March 12, 2025 Council: April 10, 2025 Posting Language ..Title Recommend approval of an ordinance repealing and replacing City Code Chapter 15-1 (Cross-Connection Regulations) to address changes to the nationally recognized plumbing codes, current Texas Commission on Environmental Quality (TCEQ) regulations and the expanded use of alternate water sources. Funding: This item has no fiscal impact. Lead Department Austin Water. Prior Council Action: January 8, 2004 – Council approved an ordinance repealing and replacing Chapter 15-1 of the City Code relating to cross-connection regulations. June 8, 2006 – Council approved an ordinance amending the definitions in Chapter 15-1 of the City Code relating to cross-connection regulations. Council Committee, Boards and Commission Action: March 12, 2025 – to be reviewed by the Water and Wastewater Commission. Additional Backup Information: Austin Water’s Cross Connection and Backflow Prevention Program administers City, state, and federal regulations to protect public health and safety. This program works to prevent cross-connections by ensuring safeguards to protect the public drinking water system from contamination hazards. Cross-connections between Austin Water’s system and alternative water systems must also be prevented to protect water quality. Regulations apply to all sites with alternative water systems, contaminants and pollutants to ensure appropriate backflow protections are in place. Backflow events occur when water flow is reversed, and non-potable water or other substances enter the drinking water system through back pressure. Austin Water ensures that backflow prevention devices are installed and maintained, which includes minimum requirements for backflow prevention assembly (BPA) installation, testing, maintenance, and reporting. This backflow prevention and cross-connection ordinance was last updated by Council in 2006, with most updates occurring in 2004. The proposed updates address properties’ increased use of alternate water systems as well as regulatory changes that EPA and TCEQ have made. Additionally, the City’s Development Services Department has requested that all plumbing code requirements for cross-connection control and backflow prevention be moved into Chapter 15-1 instead of Chapter 25-12, where the City’s Plumbing Code and local amendments are codified. The Affordability Impact Statement confirms there are no additional anticipated costs to housing and provides neutral impacts for development costs. Proposed Changes to Chapter 15-1 Attorney Client Work Product Subject to Additional Changes ORDINANCE NO. ____________ AN ORDINANCE REPEALING AND REPLACING CHAPTER 15-1 (CROSS- CONNECTION REGULATIONS). BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF AUSTIN: PART 1. City Code Chapter …
..Body Item 3 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval to authorize a contract for brush clearing on water quality protection lands managed by Austin Water for Austin Water with Summitt Forests, Inc., for an initial term of three years with up to two one-year extension options, for a total contract amount not to exceed $1,750,000. Funding: $175,000 is available in Austin Water’s Operating Budget. Funding for the remaining contract term is contingent upon available funding in future budgets. Lead Department Financial Services Department. Client Department(s) Austin Water. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 2200 SAR1006 for these services. The solicitation was issued on September 23, 2024, and closed on October 15, 2024. Of the six offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=140797 . MBE/WBE: This solicitation was reviewed for subcontracting opportunities in accordance with City Code Chapter 2-9B (Minority-Owned and Women-Owned Business Enterprise Procurement Program). For the services required for this solicitation, there were no subcontracting opportunities; therefore, no subcontracting goals were established. Council Committee, Boards and Commission Action: March 12, 2025 - To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The contract will provide juniper cutting services, brush cutting for fire line installation, and piling and removal of woody debris at Austin’s Water Quality Protection Lands (WQPL) that are required to meet the goals of restoring these selected lands to grassland and savanna ecosystems. This service will help to yield optimal water quantity and quality to recharge the Edwards Aquifer and provide sustained flow to Barton Springs, which are the primary goals of the WQPL program. This program was initiated in 1998, when Austinites voted to purchase land and conservation easements to protect the water quality and quantity in the Barton Springs segment of the Edwards Aquifer. The current land management plan that directs these practices and goals was approved by Council on January 26, 2023, Resolution 20230126-004. This contract is replacing a contract that expired May 23, 2024. The recommended contractor was the previous provider for these services. If the contract is not secured, the City will not be able to meet the goals of the WQPL …
Item 4 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 ..Title Posting Language Recommend approval to authorize a contract for wastewater flow monitoring for Austin Water with RJN Group, Inc., for an initial term of four years with up to four one-year extension options for a total amount not to exceed $18,400,000. Funding: $2,300,000 is available in Austin Water’s Fiscal Year 2024-2025 Operating Budget. Funding for the remaining contract term is contingent upon available funding in future budgets. Lead Department Financial Services Department. Client Department(s) Austin Water. Purchasing Language: The Financial Services Department issued a Request for Proposals solicitation RFP 2200 MLJ3005 for these services. The solicitation was issued on October 7, 2024, and closed on October 31, 2024. Of the three offers received, the recommended contractor submitted the best evaluated responsive offer. A complete solicitation package, including a tabulation of the bid received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm? sid=141396 . MBE/WBE: This solicitation was reviewed for subcontracting opportunities in accordance with City Code Chapter 2-9B (Minority-Owned and Women-Owned Business Enterprise Procurement Program). For the wastewater flow monitoring services required for this solicitation, there were no subcontracting opportunities; therefore, no subcontracting goals were established. Council Committee, Boards and Commission Action: March 12, 2025- To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The contract will provide wastewater flow monitoring services for over 2,800 miles of wastewater collection system piping throughout the city. Several Austin Water divisions will use different types of meters to obtain flow monitoring data to determine inflow and infiltration, serve as a warning tool for wastewater overflows, and ensure pipes and facilities are the appropriate size to safely convey wastewater from customers to treatment facilities. Data will be collected during wet and dry weather conditions to ensure that the wastewater systems have adequate capacity to convey all the wastewater in the City’s wastewater piping system. Austin Water uses the data to identify areas of concern, develop plans to provide adequate capacity, and prioritize capital improvement projects. This contract will replace a contract which expires December 20, 2025. The recommended contractor is the current provider of these services. The requested authorization amounts were determined using departmental estimates based on historical spending. Item 4 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 An evaluation team with expertise in this …
..Body Item 5 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval to authorize a contract for construction services for the Boggy Creek Lift Station Force Main Extension with Cash Construction Co Inc, in the amount of $ 15,063,376 plus a $ 1,506,338 contingency for a total contract amount not to exceed $ 16,569,714. Funding: $ 16,569,714 is available in the Capital Budget of Austin Water. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued an Invitation for Bids IFB 6100 CLMC1078 for these services. The solicitation was issued on November 11, 2024, and closed on December 19, 2024. Of the five offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=141675. MBE / WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) through the achievements of Good Faith Efforts with 0.00% MBE and 0.08% WBE participation. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater. Additional Backup Information: The Boggy Creek Lift Station Force Main Extension to the Govalle tunnel will consist of three different portions of construction: the replacement of 1,700 linear feet of existing 36-inch concrete-steel-cylinder force main located in the Govalle plant property; new construction of 1,900 linear feet of force main crossing under the Colorado River using horizontal directional drilling; and 5,700 linear feet of new High-density polyethylene (HDPE) force main from Hergotz Lane to the Lockheed shaft. The overall project length is 9,300 linear feet of 36-inch HDPE pipe. This project will abandon and replace the existing siphons under the Colorado River that are in poor condition. The construction of this force main will allow the abandonment of two siphons and the South Austin Regional Transfer Lift Station, located on the southern bank of the Colorado River and has a history of maintenance issues. During peak wet weather events, the current capacity of the existing downstream Boggy Creek Lift Station cannot adequately convey wastewater flows, causing multiple sanitary overflows into the Govalle Wastewater Treatment Plant site and the collection system upstream of the lift station. The project will reduce the possibility …
..Body Item 6 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval to authorize a contract for construction services for the Davis WTP Supervisory Control and Data Acquisition (SCADA) Improvements with Prime Controls, L.P., in the amount of $8,986,951 plus a $898,695 contingency for a total contract amount not to exceed $9,885,646. Funding: $9,885,646 is available in the Capital Budget of Austin Water. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued an Invitation for Bids IFB 6100 CLMC1082 for these services. The solicitation was issued on November 11, 2024, and closed on December 19, 2024. The recommended contractor submitted the only responsive offer. A complete solicitation package, including a tabulation of the bid received, is available for viewing on the City’s website. This information can currently be found at 140369. https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=141719. MBE / WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 4.36% MBE and 0.38% WBE participation. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The City of Austin utilizes surface water resources from impoundments of the Colorado River for its potable water supply. Austin Water operates three existing Water Treatment Plants (WTPs), which are Ullrich , Davis and Handcox . The Davis plant has been in service since 1954 and has a rated treatment capacity of 118 million gallons per day (MGD). Davis’ Supervisory Control and Data Acquisition (SCADA) equipment and network infrastructure are essential to the operation of the facility. The existing equipment has exceeded its service life and is now obsolete, no longer supported by the manufacturers, and difficult to maintain. This equipment needs to be replaced and upgraded to maintain reliability. This project will replace existing Programmable Logic Controller (PLC) equipment with new PLCs throughout the plant, including installation of necessary fiber optic cable, electrical conduit, and wire. The work consists of demolition of existing PLCs and network communications systems and furnishing and installing new PLCs and network communications systems in the Administration Building, Filter Building, Chemical Building, Centrifuge Building, Recycle Pump Station Nos. 1 & 2 and Low Service Pump Station areas of the plant. Item 6 Water & Wastewater Commission: March 12, 2025 Council: March 27, …
..Body Item 7 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval to authorize additional expenditures for the construction contract for the Polybutylene Water Services Replacement Program project with Austin Underground Inc., to increase the amount by $864,030 for a revised total contract amount not to exceed $10,434,354. Funding: $10,434,354 is available in the Capital Budget of Austin Water. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: Additional Authorization. MBE / WBE: Note: This request is for additional expenditure authority only. MBE/WBE goals will be established if a change order is requested. Prior Council Action: December 9, 2021 – Council approved a contract with Austin Underground, Inc. for the Polybutylene Water Services Replacement Program project. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: Austin Water’s distribution system is large and complex, consisting of approximately 3,900 miles of water mains and serving approximately one million customers. Distribution system assets require ongoing repair and replacement to prevent leaks and loss of valuable treated water because of deterioration due to environmental conditions and aging. Water service lines made of polybutylene or polyethylene fail at a much higher rate compared to other materials such as copper or high-density polyethylene . Failure rates for polybutylene or polyethylene pipes increase at higher pressures. The cost of proactively replacing a service as part of a construction contract is about 30% less than the cost to reactively repair or replace using Austin Water’s Distribution System Maintenance crews. Proactive service line replacement also results in less water loss and fewer unscheduled customer service outages. Since 2001, Austin Water has been proactively replacing polybutylene and polyethylene services in areas of high static pressure using both internal forces and contractor resources. Under the Polybutylene Water Services Replacement Program project, approximately 2,200 polybutylene and polyethylene water services with pressures exceeding 105 pounds per square inch are being replaced with copper services in 62 subdivisions. Many of these services have previously experienced one or more breaks with subsequent repair by Distribution System Maintenance crews. Construction is currently ongoing and is projected to be completed in Spring 2025. Item 7 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Due to significant field-verified deviations with existing utilities, unexpected conditions encountered during construction; and the need to repave …
Item 8 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 ..Title Posting Language Recommend approval to authorize a contract for a mobile medium voltage switchgear breaker for Austin Water with Graybar Electric Company, Inc., in an amount not to exceed $159,893. Funding: $159,893 is available in Austin Water’s Fiscal Year 2024-2025 Operating Budget. ..Body Lead Department Financial Services Department. Client Department(s) Austin Water. Purchasing Language: The Financial Services Department issued an Invitation for Bids solicitation IFB 2200 RBB1005REBID for these goods. The solicitation was issued on November 12, 2024, and closed on December 19, 2024. Of the two offers received, the recommended contractor submitted the lowest responsive offer. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=141900 . MBE/WBE: This solicitation was reviewed for subcontracting opportunities in accordance with City Code Chapter 2-9B (Minority-Owned and Women-Owned Business Enterprise Procurement Program). For the goods required for this solicitation, there were no subcontracting opportunities; therefore, no subcontracting goals were established. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This contract is for a single mobile medium voltage switchgear breaker to power large emergency generators for extended power during outages or extreme weather events. The breaker will isolate power between a medium voltage transformer (15kV) and the pump station utility transformer. The breaker will allow the utility to become more resilient during extreme weather events or power failures that affect the incoming power to a critical pumping station. The breaker provides a contingency plan that follows the Federal Power Act and Texas Senate (SB 3) regarding preparing for, preventing, and responding to weather emergencies. Austin Water has already purchased emergency generators with low voltages, as such the breaker will be used between the low generator voltages to isolate and protect the equipment. If a contract is not secured, Austin Water’s resiliency goal will be hindered because the department will not be able to isolate power during extreme weather or power failures, which will result in higher operational costs due to loss of power.
Item 9 Water & Wastewater Commission: March 12, 2025 Council: March 27, 2025 Posting Language ..Title Recommend approval of an ordinance amending the Fiscal Year 2024-2025 Austin Water Operating Budget (Ordinance No.20240816-004) for the purpose of defeasing and redeeming outstanding bonds, by amending transfer for an increase in transfer in for a net amount of $2,000,000; an increase expenditures in a net amount of $5,000,000 for a net impact of $(3,000,000) to the ending fund balance; and amending the Fiscal Year 2024-2025 Combined Utility Revenue Bond Redemption Fund (Ordinance No. 20240816-004) to increase the transfer in for a net amount of $7,215,206 and increase expenditures in a net amount of $7,215,206. Funding is available in the ending balances of the FY 2024-2025 Austin Water operating funds. Reduction of these ending balance will maintain Austin Water’s compliance with relevant City financial policies. ..De Lead Department Austin Water Prior Council Action: August 16, 2024 – Council approved an ordinance adopting the Operating Budget for the Fiscal Year 2024-2025. Council Committee, Boards and Commission Action: March 12, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: This budget amendment is related to the defeasance item that would authorize Austin Water to pay off certain maturities of the City’s outstanding Water and Wastewater System Revenue Refunding Bonds. A defeasance is a method of using available cash to pay off outstanding debt. The cash is placed in an escrow account held by a trustee to make principal and interest payments on the required payment date for the bonds being defeased until redemption or maturity. Once the defeasance is funded, the obligations payable from the escrow are no longer secured by or payable from the revenues initially pledged to their payment. The proposed related defeasance item seeks authorization to pay off certain maturities of the City’s outstanding Water and Wastewater System Revenue Refunding Bonds. This process allows Austin Water to remove the debt from its books, which reduces debt levels, reduces interest expense, and improves debt service coverage by lowering the burden of debt service payments in the short-term. Also, this proposed defeasance action is in direct relation to achieving a Water and Wastewater System rate stability over the next few years. The total source of funds for the defeasance of $40,215,206 will be provided from a combination of $3,000,000 in Austin Water Operating Funds, $34,000,000 in Impact Fee/CRF collections, $1,000,000 …
Item 2 Water & Wastewater Commission: March 12, 2025 Council: April 10, 2025 Summary of Proposed Updates to Austin City Code Chapter 15-1 Cross-Connection Regulations Overview Since the last update to Austin City Code Chapter 15-1, significant changes have been made to nationally recognized plumbing codes, as well as Texas Commission on Environmental Quality (TCEQ) and American Water Works Association (AWWA) standards. There have also been overall changes in the approach to water use, with increased use of alternate water sources. These recommended updates also align with a request from the Development Services Department (DSD) to move the 2024 Uniform Plumbing Code’s (UPC) requirements for cross-connection regulations to Chapter 15-1. Summary of Updates The requested updates are supported by nationally approved plumbing codes, Texas Commission on Environmental Quality (TCEQ) regulations, American Waterworks Association (AWWA) standards, and other nationally recognized standards. Article 1. General Provisions (pages 1-5) • Added definitions and wording changes for further clarity Article 2. Cross-Connection Control (pages 5-50) • Updated language directly from the 2021UPC local amendments and the 2024 UPC, primarily found in 15-1-13-20 • Removed requirement of Test and Maintenance Reports (TMR) from customer to testers Article 3. Tester Registration (pages 50-54) • This section provides the requirements for backflow prevention testers, cross- connection testers, and customer service inspectors • Minor adjustments were made to require the maintenance of contact information and to allow for electronic TMRs Article 4. Connection By Other Public Water System (pages 54-57) • No changes Article 5. Enforcement (pages 57-66) • Minor wording changes for further clarity
Regular Meeting of the Water and Wastewater Commission February 19, 2025 — 4:00 pm Austin Water Headquarters Waller Creek Center 625 East 10th Street, Austin Texas Some members may be participating by videoconference. The meeting may be viewed online at: http://www.austintexas.gov/page/watch-atxn-live For more information go to: http://www.austintexas.gov/wwc Public comment will be allowed in-person or remotely by telephone. Speakers may only register to speak on an item once either in-person or remotely and will be allowed up to three minutes to provide their comments. Registration no later than noon the day before the meeting is required for remote participation. To register, call or email the board liaison Heather Cooke at 512-972-0083 or Heather.Cooke@austintexas.gov . To register to speak in person, people must sign up at least ten minutes before the meeting is called to order. Mike Reyes, (District 4) Vacant (District 5) Shwetha Pandurangi (District 6) Judy Musgrove (District 7) Christopher Maxwell-Gaines, Vice Chair (District 8) Marcela Tuñón Sion (District 9) Susan Turrieta, Chair (District 10) Commissioners: William Moriarty (Mayor) Jesse Penn (District 1) Alex Navarro (District 2) Amanda Marzullo (District 3) CALL TO ORDER PUBLIC COMMUNICATION: GENERAL APPROVAL OF MINUTES DISCUSSION AND ACTION 1. Approval of minutes from the January 15, 2025 regular meeting of the Water and Wastewater Commission. 2. Recommend approval to authorize a contract for construction services for the 2020 Bond Substandard Streets Ross Road North with DeNucci Constructors, LLC, in the amount of $29,650,594.00 plus a $2,965,059.40 contingency for a total contract amount not to exceed $32,615,653.40. Funding in the amount of $29,669,890.33 is available in the Capital Budget of the Transportation and Public Works Department and Funding in the amount of $2,945,763.07 is available in the Capital Budget of Austin Water. 3. Recommend approval of an ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Funding: This item has no fiscal impact. The City of Austin is committed to compliance with the American with Disabilities Act. Reasonable modifications and equal access to communications will be provided upon request. Meeting locations are planned with wheelchair access. If requiring Sign Language Interpreters or alternative formats, please give notice at least 2 days (48 hours) before the meeting date. Please call Heather Cooke at Austin Water, 512-972-0083 for additional information; TTY users’ route through Relay Texas at 711. …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, January 15, 2025 The Water and Wastewater Commission convened in a regular called meeting on January 15, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Chair Turrieta called the Water and Wastewater Commission to order at 4:06 p.m. Commission Members in Attendance: Chair Susan Turrieta, Vice Chair Christopher Maxwell-Gaines, Judy Musgrove, Shwetha Pandurangi, Mike Reyes, Marcela Tunon Sion (Remote), Amanda Marzullo, Alex Navarro, William Moriarty, Jesse Penn PUBLIC COMMUNICATION: GENERAL There were no registered public speakers APPROVAL OF MINUTES 1. Approval of minutes from the December 4, 2024, regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Pandurangi’s motion and Commissioner Maxwell- Gaines’ second on a 10-0 vote DISCUSSION AND ACTION 2. Recommend approval to authorize negotiation and execution of a collection agreement with the United States Department of Agriculture, U.S. Forest Service Pacific Northwest Research Station, for the purpose of re- evaluating fuels in closed canopy Ashe Juniper-oak woodlands, for a term of three years, in an amount not to exceed $198,467. Funding is available in the Balcones Canyonlands Conservation Plan Fund and the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining term is contingent upon available funding in future budgets. Recommended on Commissioner Marzullo’s motion and Commissioner Penn’s second on a 10-0 vote 3. Recommend approval to authorize a contract for cold-water meters for Austin Water with Thirkettle Corporation d/b/a Aqua-Metric Sales Company, for an initial term of one year with up to two one-year extension options for a total contract amount not to exceed $6,000,000. Funding: $900,000 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining contract term is contingent upon available funding in future budgets. Recommended on Commissioner Marzullo’s motion and Commissioner Penn’s second on a 10-0 vote 4. Recommend approval to authorize execution of a contract for liquid polymer for thickening and dewatering sludge for Austin Water with Polydyne Inc., for an initial term of three years with up to two one-year extension options, for a total contract amount not to exceed $6,000,000. Funding: $900,000 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining contract term is contingent upon available funding in future budgets. Recommended on Commissioner Marzullo’s motion and Commissioner Penn’s second on a 10-0 vote 5. Recommend approval …
..Body Item 2 Water & Wastewater Commission: February 19, 2025 Council: February 27, 2025 Posting Language ..Title Recommend approval to authorize execution of a contract for construction services for the 2020 Bond Substandard Streets Ross Road North project, for the Transportation and Public Works Department and Austin Water and to be managed by Capital Delivery Services, with DeNucci Constructors, LLC, in the amount of $29,650,594.00 plus a $2,965,059.40 contingency for a total contract amount not to exceed $32,615,653.40. Funding: $29,669,890.33 is available in the Capital Budget of the Transportation and Public Works Department and Funding in the amount of $2,945,763.07 is available in the Capital Budget of Austin Water. Lead Department Financial Services Department. Managing Department Capital Delivery Services. Purchasing Language: The Financial Services Department issued an Invitation for Bids IFB 6100 CLMC1068 for these services. The solicitation was issued on October 7, 2024, and closed on January 9, 2025. Of the six bids received, the recommended contractor submitted the lowest responsive bid. A complete solicitation package, including a tabulation of the bids received, is available for viewing on the City’s website. This information can currently be found at https://financeonline.austintexas.gov/afo/account_services/solicitation/solicitation_details.cfm?sid=141362. MBE / WBE: This contract will be awarded in compliance with City Code Chapter 2-9A (Minority-Owned and Women- Owned Business Enterprise Procurement Program) by meeting the goals with 5.81% MBE and 1.51% WBE participation. Council Committee, Boards and Commission Action: February 19, 2025 – To be reviewed by the Water and Wastewater Commission. Additional Backup Information: The City evaluated Ross Road, in a Preliminary Engineering Report (PER) as part of the 2016 Mobility Bond to develop recommendations to improve mobility and safety along the project area. The project area in the PER includes Ross Road between State Highway 71 and Pearce Lane (referred in the report as “Ross Road North”) and between Pearce Lane and Heine Farm Road (referred to as “Ross Road South”). This project scope is for the construction of Ross Road North only. Ross Road South is being designed under the jurisdiction of Travis County. The proposed improvements are focused on reducing congestion and enhancing safety by improving vehicular traffic flow, reducing delays at intersection points, providing alternative modes of transportation, and reducing the number of collision points. The proposed improvements include: • Expansion of Ross Road North to include two lanes in each direction; addition of left turn pockets at key intersections; addition of curb and …
..De Item 3 Water & Wastewater Commission: February 19, 2025 Council: February 27, 2025 Posting Language ..Title Recommend approval of an ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Funding: This item has no fiscal impact. Lead Department Austin Water. Prior Council Action: December 11, 2019 – City Council voted to approve the Land Development Code Revision directing Austin Water to establish a regulatory program and an incentive program for Onsite Water Reuse Systems on first reading, on a 7-4 vote. February 13, 2020 – City Council voted to approve the Land Development Code Revision directing Austin Water to establish a regulatory program and an incentive program for Onsite Water Reuse Systems on second reading, on a 7-4 vote. December 10, 2020 - City Council approved an ordinance establishing City Code Chapter 15-13 relating to treatment, monitoring and reporting regulations for Onsite Water Reuse Systems, on a 10-0 vote. April 22, 2021 – City Council voted to approve an initial Pilot Incentive Program for Onsite Water Reuse Systems for the voluntary installation of alternative Onsite Water Reuse Systems, on a 10-1 vote. May 20, 2021 – City Council adopted a resolution directing staff to prepare an ordinance amending City Code Chapter 25-9 (Water and Wastewater) establishing water benchmarking, expanding Reclaimed Water Connection requirements, and adding Onsite Water Reuse requirements, on an 11-0 vote. June 10, 2021 – City Council adopted an ordinance waiving Planning Commission review of Land Development Code amendments in order to expedite implementation of water conservation strategies in the Water Forward Plan, on an 11-0 vote. September 30, 2021 – City Council adopted an ordinance amending City Code Chapter 25-9 (Water and Wastewater) relating to establishing new requirements for water conservation in the implementation of the Water Forward Plan, including expansion of the Reclaimed Water Connection requirement, water benchmarking, and mandatory Onsite Water Reuse for certain new developments and requiring an affordability report, on a 10-1 vote. November 9, 2023 – City Council adopted an ordinance to amend Ordinance #20210930-117 to defer the effective date for Onsite Water Reuse requirements for large development projects, on a 7-1 vote. March 7, 2024 – City Council adopted an ordinance amending City Code Chapter 25-9 (Water and Wastewater) relating to clarifying requirements for water conservation in the implementation of …
Wastewater Billing Ordinance for Onsite Water Reuse Systems Katherine Jashinski, P.E. Supervising Engineer February 19th, 2025 Water & Wastewater Commission Agenda Intro to GoPurple and Onsite Water Reuse Options for Billing for Wastewater Wastewater Flow Factor Billing Proposed Ordinance Q&A 2 Intro to GoPurple and Onsite Water Reuse GoPurple Austin City Council Adoption on March 7th 2024 Code Changes for Onsite Water Reuse and Reclaimed Water Connections Affordability Strategies for Reuse Projects New community Benefit Charge increase ($0.15 per thousand gallons) to fund Reclaimed Water System expansion and Onsite Reuse programs Go Purple | AustinTexas.gov 4 Requirements for Onsite Water Reuse Systems Project Size Other Project Characteristics Required Sources 250,000 sf or greater of GFA Project has one or more commercial, multifamily or mixed use buildings Combined AC condensate and Rainwater Exception: project has four or more multifamily buildings with a FAR <1 Combined AC condensate and Rainwater Required End Uses Irrigation Toilet/urinal Cooling Tower Irrigation AC condensate Cooling Tower Less than 250,000 sf of GFA Project has a cooling tower of 100 tons or greater capacity GFA = Gross Floor Area FAR = Floor to Area Ration 5 Accounting for Wastewater Contributions from Onsite Water Reuse Systems 6 Austin Central Library: Lessons Learned 7 Considerations for Private Meters for Wastewater Billing 8 Cost to add additional metering reduces the affordability of the systems Location of private meters within buildings requires self-reporting Maintenance and calibration of meters increases workload for facility managers Manual Billing to get meter reads into Austin's billing system adds substantial workload and increases staffing needs at AW Options for Billing for Wastewater 1. Wastewater averaging 2. Gallon for gallon 3. Wastewater billing adjustments for evaporative cooling towers 4. Metered wastewater billing City Code Chapter 15-9 (Utility Regulations) City Code Specifies Current Options for Wastewater Billing 10 Metering and Billing for Existing Customers Residential Commercial ~ 95% of AW customers ~5% of AW customers Wastewater Averaging Water = Domestic meter consumption WW = Average meter consumption Nov-March Gallon for Gallon Water = Domestic + Irrigation meter consumption WW = Domestic meter consumption 11 Evaporative Loss Adjustment Program for Cooling Towers Private meter IN Approximately 120 AW customers participate These customers: • reapply every 5 years • are responsible for the ownership and maintenance of their private meters which support the cooling tower system • self …
MY ATX WATER Austin’s Smart Metering System Randi Jenkins, Assistant Director Water & Wastewater Commission February 19, 2025 AGENDA Overview Citywide Implementation Substantial Completion & System Performance Communications, Customer Interactions & Benefits Testimonials Next Steps 2 My ATX Water OVERVIEW Network Configuration My ATX Water Customer Portal Data Collection Unit Secure Wireless Network Billing and Data Analytics 3 Citywide Implementation • Pre-planning & Pilots • Exchanging 250,000+ analog meters • Customer portal for real-time water metrics, alerts, tips, and customization • What made this project different? • Reaching Customers • Interactive Map • Quality Assurance & Meter to Bill Processes 4 Reaching Customers Customer mailer (4 weeks prior to install) Email (~1 week prior to install) Neighborhood yard signs Virtual community information meetings HOA/Neighborhood Association notifications Social Media center 5 Post install welcome & available call Quality Assurance & Meter to Bill Process Quality control has been integral to success • Each My ATX Water meter is tested by manufacturer for accuracy • AW conducts additional tests on a representative sample of meters to validate accurate Each My ATX Water meter undergoes 10-step certification process after registered readings installation After installation, manual and electronic reads are conducted simultaneously through two billing cycles before switching to fully electronic reads 6 SUBSTANTIAL COMPLETION & SYSTEM PERFORMANCE 7 Substantial Completion & System Performance 100% Data Collection Units operating Averaging 99.96% billable reads each month 98.86% of 258,957 meters exchanged What is left? • 623 large meters to be converted by contractor • 429 1-inch, 1.5-inch, and 2-inch Turbine meters are on back order from Badger • 585 small meters require a maintenance task to complete AMI compatibility • 94 fire demand meters - hiring engineering firm to survey sites and bid a contract 8 COMMUNICATIONS, CUSTOMER INTERACTIONS AND BENEFITS 9 Communications AW has sent 5M portal communications • drought and water conservation education, water quality report, emergency and planned events, customer surveys, and more. Weekly install and portal recruitment email open rate at ~70% (above industry average). Continued communications on the horizon are the Water Quality Report, water conservation including encouragement to customize their home water profile, budget, and rates. 10 As of 9/27, 98 open issues currently being worked As of 9/27, 4,242 issues resolved Customer Interactions 499,005 Leak & Bill Forecast Notifications since 2021 Leak Notifications in 2024 • 148,134 detected • 65% …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, February 19, 2025 The Water and Wastewater Commission convened in a regular called meeting on February 19, 2025 at Waller Creek Center, 625 E 10th Street, Austin, Texas. Chair Turrieta called the Water and Wastewater Commission to order at 4:02 p.m. Commission Members in Attendance: Chair Susan Turrieta, Vice Chair Christopher Maxwell-Gaines, Judy Musgrove (remote), Mike Reyes, Marcela Tuñón Sion, Amanda Marzullo (remote), Alex Navarro, William Moriarty, Jesse Penn Commission Members Absent: Shwetha Pandurangi PUBLIC COMMUNICATION: GENERAL There were no registered public speakers APPROVAL OF MINUTES 1. Approval of minutes from the January 15, 2025, regular meeting of the Water and Wastewater Commission. The minutes were approved on Commissioner Moriarty’s motion and Commissioner Maxwell-Gaines’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. DISCUSSION AND ACTION 2. Recommend approval to authorize a contract for construction services for the 2020 Bond Substandard Streets Ross Road North with DeNucci Constructors, LLC, in the amount of $29,650,594.00 plus a $2,965,059.40 contingency for a total contract amount not to exceed $32,615,653.40. Funding in the amount of $29,669,890.33 is available in the Capital Budget of the Transportation and Public Works Department and Funding in the amount of $2,945,763.07 is available in the Capital Budget of Austin Water. Recommended on Commissioner Tuñón Sion’s motion and Commissioner Reyes’ second on an 8-0 vote with Commissioner Pandurangi absent and Commissioner Marzullo off the dais. 3. Recommend approval of an ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Funding: This item has no fiscal impact. Recommended on Commissioner Maxwell-Gaines’ motion and Commissioner Moriarty’s second on a 9-0 vote with Commissioner Pandurangi absent. STAFF BRIEFINGS 4. Staff briefing on proposed ordinance amending City Code Chapter 15-9 (Utility Service Regulations) to authorize an alternative wastewater billing methodology for customers with onsite water reuse systems and customers with evaporative loss from cooling towers. Supervising Engineer Katherine Jashinski provided a briefing and answered questions from Commissioners 5. Staff briefing on My ATX Water program implementation update. Assistant Director Randi Jenkins provided a briefing and answered questions from Commissioners COMMITTEE UPDATES 6. Update from the Austin Integrated Water Resource Planning Community Task Force meeting regarding Water Forward Plan implementation – Commissioner William Moriarty provided an update 7. Update …
Regular Meeting of the Water and Wastewater Commission January 15, 2025 — 4:00 pm Austin Water Headquarters Waller Creek Center 625 East 10th Street, Austin Texas Some members may be participating by videoconference. The meeting may be viewed online at: http://www.austintexas.gov/page/watch-atxn-live For more information go to: http://www.austintexas.gov/wwc Public comment will be allowed in-person or remotely by telephone. Speakers may only register to speak on an item once either in-person or remotely and will be allowed up to three minutes to provide their comments. Registration no later than noon the day before the meeting is required for remote participation. To register, call or email the board liaison Heather Cooke at 512-972- 0083 or Heather.Cooke@austintexas.gov . To register to speak in person, people must sign up at least ten minutes before the meeting is called to order. Mike Reyes, (District 4) Vacant (District 5) Shwetha Pandurangi (District 6) Judy Musgrove (District 7) Christopher Maxwell-Gaines, Vice Chair (District 8) Marcela Tuñón Sion (District 9) Susan Turrieta, Chair (District 10) Commissioners: William Moriarty (Mayor) Jesse Penn (District 1) Alex Navarro (District 2) Amanda Marzullo (District 3) CALL TO ORDER PUBLIC COMMUNICATION: GENERAL APPROVAL OF MINUTES DISCUSSION AND ACTION 1. Approval of minutes from the December 4, 2024, regular meeting of the Water and Wastewater Commission. 2. Recommend approval to authorize negotiation and execution of a collection agreement with the United States Department of Agriculture, U.S. Forest Service Pacific Northwest Research Station, for the purpose of re- evaluating fuels in closed canopy Ashe Juniper-oak woodlands, for a term of three years, in an amount not to exceed $198,467. Funding is available in the Balcones Canyonlands Conservation Plan Fund and the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining term is contingent upon available funding in future budgets. 3. Recommend approval to authorize a contract for cold-water meters for Austin Water with Thirkettle Corporation d/b/a Aqua-Metric Sales Company, for an initial term of one year with up to two one-year extension options for a total contract amount not to exceed $6,000,000. Funding: $900,000 is available in the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining contract term is contingent upon available funding in future budgets. The City of Austin is committed to compliance with the American with Disabilities Act. Reasonable modifications and equal access to communications will be provided upon request. Meeting locations are planned with wheelchair access. …
WATER AND WASTEWATER COMMISSION REGULAR CALLED MEETING MINUTES Wednesday, December 4, 2024 The Water and Wastewater Commission convened in a regular called meeting on December 4, 2024, at Waller Creek Center, 625 E 10th Street, Austin, Texas. Chair Turrieta called the Water and Wastewater Commission to order at 6:02 p.m. Commission Members in Attendance: Chair Susan Turrieta, Vice Chair Christopher Maxwell-Gaines, Judy Musgrove, Shwetha Pandurangi, Mike Reyes, Marcela Tunon Sion, Amanda Marzullo, Alex Navarro (Remote), William Moriarty (Remote) Commission Members Absent: Jesse Penn PUBLIC COMMUNICATION: GENERAL There were no registered public speakers. APPROVAL OF MINUTES 1. Approval of minutes from the November 13, 2024, regular meeting of the Water and Wastewater Commission. The minutes from the November 13, 2024, regular meeting were approved on Commissioner Pandurangi’s motion and Commissioner Tunon Sion’s second on a 9-0 vote with Commissioner Penn absent. DISCUSSION AND ACTION 2. Recommend approval to authorize negotiation and execution of an interlocal agreement with the cities of Round Rock, Cedar Park, and Leander for the reimbursement of costs related to the rehabilitation of the East Wastewater Treatment Plant of the Brushy Creek Regional Wastewater System and authorize the City's share of funding for capital improvements to the East Regional Wastewater Treatment Plant in an amount not to exceed $1,400,000. Funding in the amount of $1,400,000 is available in the Fiscal Year 2024-2025 Capital Budget of the Austin Water Department. Funding for the remaining contract term is contingent upon available funding in future budgets. Recommended by the Water and Wastewater Commission on Commissioner Pandurangi’s motion and Commissioner Tunon Sion’s second on a 9-0 vote with Commissioner Penn absent. 3. Recommend approval to authorize execution of a contract for construction services for the Ivanhoe Trail Water Pipeline Renewal with Facilities Rehabilitation Inc. in the amount of $2,977,416 plus a $297,742 contingency for a total contract amount not to exceed $3,275,158. Funding is available in the Capital Budget of Austin Water. (District 5) Recommended by the Water and Wastewater Commission on Commissioner Pandurangi’s motion and Commissioner Tunon Sion’s second on a 9-0 vote with Commissioner Penn absent. 4. Recommend approval to authorize execution of a contract for construction services for the Northwest Area Lift Station Improvements: Boulder Lane Lift Station project with C.C. Carlton Industries, LTD in the amount of $6,881,000 plus a $688,100 contingency for a total contract amount not to exceed $7,569,100. Funding is available in the Capital Budget …
..De Item 2 Water & Wastewater Commission: January 15, 2025 Council: January 30, 2025 Posting Language ..Title Recommend approval to authorize negotiation and execution of a collection agreement with the United States Department of Agriculture, U.S. Forest Service Pacific Northwest Research Station, for the purpose of re-evaluating fuels in closed canopy Ashe Juniper-oak woodlands, for a term of three years, in an amount not to exceed $198,467. Funding is available in the Balcones Canyonlands Conservation Plan Fund and the Fiscal Year 2024-2025 Operating Budget of Austin Water. Funding for the remaining term is subject to available funding in future budgets. Lead Department Austin Water. Council Committee, Boards and Commission Action: January 15, 2025 – to be reviewed by the Water and Wastewater Commission. Additional Backup Information: The purpose of this Collection Agreement is to engage in a re-assessment of wildland fire fuels on land managed by Austin Water under the Balcones Canyonlands Preserve. The assessment, to be conducted by experts with the Fire and Environmental Research Applications Team of the Pacific Northwest Research Station of the Forest Service, US Department of Agriculture (USFS FERA), will enhance and improve upon the information collected during the 2007 “Baylor Study”, a fuels assessment of the Balcones Canyonlands Preserve conducted by Dr. Joseph White and Baylor University’s Geospatial Lab. Significant change has occurred in this landscape since the Baylor Study was completed, including three severe droughts and two major winter storms. Updated information is needed to accurately capture the condition of wildland fire fuels and inform possible management strategies. Data collection in the field is expected to begin as early as February 2025 and is expected to conclude by July 2025. Data processing will occur over summer 2025, with preliminary data available as early as July 2025. Processed deliverables are expected Winter 2025/2026. Subsequent data collection and analysis may occur through 2028. Deliverables will include: • Data set of re-measurements of Baylor University study plots. USFS FERA will remeasure a subset of the 31 Baylor University study plots and provide a database listing fuel parameters that can be directly compared with the 2007 fuels assessment. This will also include data on new fuel strata measured as part of this assessment. This information can be used to inform management goals and hazard assessment. • Seminar and meetings for City of Austin staff. USFS FERA staff will review findings, answer questions, and provide consultation regarding appropriate …