Planning Commission – Oct. 11, 2022

24 C20-2021-014 Project Connect.pdf — original pdf

Backup
Thumbnail of the first page of the PDF
Page 1 of 9 pages

C20-2021-014 ORDINANCE AMENDMENT REVIEW SHEET Amendment: C20-2021-014 Project Connect Ordinance Description: Consider an amendment to Title 25 City Code for Transit System Projects to facilitate the construction of critical transportation infrastructure. Proposed Language: See attached draft ordinance and background information. Summary of proposed code amendment This is a Foundational Ordinance, creating a place for any future code amendments, and proposes 5 main components: • Structure (as a foundational ordinance) • Requiring a construction noise and mitigation plan • Adjustments to site plan • Establish uses • Fiscal exemption beyond the ROW Background: Initiated by City Council Resolution 20211029-003 In October of 2021, Council passed a resolution directing staff to scan code, criteria and processes looking for obstacles to efficient implementation and permitting of Project Connect. The resolution cites the City’s mobility plan, the voter referendum for Project Connect, the ENO report, and the known difficulties of Austin’s codes and ordinances in implementing a linear project. Staff Recommendation: Staff recommends the proposed code amendment. Board and Commission Actions September 21, 2022: Went before Codes and Ordinances Joint Commission; unable to hear item due to lack of quorum. October 4, 2022: Scheduled to go before the Urban transportation Commission. October 5, 2022: Scheduled to go before the Environmental Commission. October 11, 2022: Scheduled to go before the Planning Commission. October 18, 2022: Scheduled to go before the Zoning and Platting Commission. October 19, 2022: Scheduled to go before the Downtown Commission October 24, 2022: Scheduled to go before the Design Commission. Council Action December 1, 2022: Suggested date/time Ordinance Number: NA City Staff: Donna Galati Phone: 512-974-2733 Email: donna.galati@austintexas.gov 1 1 of 924 VERSION TWO PROPOSED LANGUAGE FOR PROJECT CONNECT ORDINANCE DRAFT SUBJECT TO ADDITIONAL CHANGES Project Connect is the City’s high-capacity public transit system expansion, PART 1. which will ultimately consist of a light rail network, an expanded bus system, transportation terminals and stations, maintenance facilities, and all associated improvements necessary for operation of the transit system. To facilitate the construction of this critical transportation infrastructure, certain modifications and waivers to City Code are necessary to ensure the construction of a high-capacity transit system. PART 2. This ordinance and the attached Exhibits A and B consist of the “Transit System Project Regulations”. Development of the Transit System Project shall conform to the limitations and conditions set forth in this ordinance. If this ordinance and the attached exhibits conflict, this ordinance controls. Except as otherwise provided by this ordinance, all other rules, regulations, and ordinances of the City apply. PART 3. The attached exhibits are incorporated into this ordinance in their entirety as though set forth fully in the text of this ordinance. The exhibits are as follows: A. B. Transit System Project Exhibit Rail Construction Noise and Mitigation Plan Requirements PART 4. Definitions. A) Transit System Project means a transportation project generally depicted on Exhibit A with any related appurtenances, including but not limited to a rail and public transit line, rail station, or a transportation terminal, funded by a public entity. [and located on publicly owned land or in the right-of-way or a public easement.] B) Unless otherwise specifically defined, all terms in this ordinance shall have the meaning established in Title 25 of Code of the City of Austin, Texas (the “Land Development Code”). PART 5. A Transit System Project for rail lines or any associated infrastructure necessary to construct the rail lines must comply with a noise and mitigation plan approved by the City that meets the requirements listed in Exhibit B. To the extent there is a conflict with Chapter 9-2 (Noise and Amplified Sound), the approved noise and mitigation plan will control. 2 of 924 VERSION TWO PROPOSED LANGUAGE FOR PROJECT CONNECT ORDINANCE DRAFT SUBJECT TO ADDITIONAL CHANGES PART 6. Transit System Uses as described in 25-2-6(28). A) The use of a site for a traction powered substation is a Local Utility Service use B) The use of a site for the provision of maintenance, repair, vehicular or equipment servicing, material storage, or similar activities for rail lines is a Maintenance and Facilities use as described in 25-2-6 (29). PART 7. Code Modifications. The following code modifications apply to a site plan application for a Transit System Project. A) Site Plan 1. Subsection (B) of Section 25-5-21 (Phased Site Plan) is modified to allow the director to approve development phasing if the date on the final phase is not more than ten years after the approval date of the site plan. Planning Commission approval is required for development phasing if the date proposed for beginning construction of a phase is more than ten years after the approval date of the site plan. 2. Section 25-5-23 (Fast Track Permit) is modified to allow the director to approve a fast-track permit that does not require a certificate of occupancy. Section 25- 5-23 (Fast Track Permit) is further modified to allow the director to approve a fast-track permit that requires a variance. 3. Section 25-5-81 (Site Plan Expiration) is modified to allow a site plan to expire 10 years after its approval. 4. Section 25-5-113 (Updates) is modified to allow an applicant to file an update to a site plan up to five years after the date the application is filed. Days may still be added to the update deadline under Section 25-1-88 (A) (Extension of Update Deadline). For a site plan submitted under Section 25-5-21 (Phased Site Plan), additional development phases can be added to an approved site plan and those development phases shall be considered an update subject to the five- year update deadline. B) Fiscal City Code Section 25-1-112 (Fiscal Security) is modified such that a Transit System Project is not required to post fiscal. 3 of 924 INITIAL INVESTMENT | August 2021 SOUTHEND Lago Vista Pickup Zone FOUR POINTS OHLEN B u r n e t R d NORTHCROSS R R E E D D L L I I N N E E LBJ High School E E N N I I L L N N E E E E R R G G To Hutto 130 TOLL ELGIN ELGIN MANOR MANOR WILDHORSE WILDHORSE WILDHORSE LEANDER LEANDER LAKELINE LAKELINE LAKELINE HOWARD HOWARD To Georgetown Pflugerville Pickup Zone Stoney Creek Park TECH RIDGE TECH RIDGE TECH RIDGE TRANSIT CENTER TRANSIT CENTER TRANSIT CENTER 45 TOLL PARMER PARMER Howard Ln 325 Walnut Creek Metro Park PARMER ACC Northridge BROADMOOR/DOMAIN BROADMOOR/DOMAIN BRAKER LN BRAKER KRAMER MCKALLA MCKALLA M e t r i c B l RUTLAND CROSSROADS LOOP 360 CRESTVIEW CRESTVIEW CRESTVIEW A A B B M M N N U U E E D D R R N N N N O O C C E E A A H H T T K K A A T T C C H H O O A A I I L L L L ALLANDALE KOENIG KOENIG NORTH LOOP TEXAS HEALTH COMMISSION A A C C C C H H I I G G H H L L A A N N D D T T O O T T E E C C H H R R I I D D G G E E RUNDBERG 325 Rundberg Ln NORTH LAMAR NORTH LAMAR NORTH LAMAR TRANSIT CENTER TRANSIT CENTER TRANSIT CENTER 325 10 N L a m a r B l St Johns Ave 300 E x p o s i t i o n B l 335 Seton Hospital L a m a r B l UT/WEST MALL UT/WEST MALL Enfield Rd DOWNTOWN AREA DELCO CENTER DELCO CENTER d r R o n a M SPRINGDALE SHOPPING CENTER PHILOMENA BERKMAN/ MUELLER M LK Bl Oak Springs Dr ACC EASTVIEW GOVALLE GOVALLE HIGHLAND HIGHLAND HIGHLAND HIGHLAND TRIANGLE TRIANGLE TRIANGLE TRIANGLE 7 HYDE HYDE PARK PARK HEMPHILL HEMPHILL PARK PARK ST. DAVID’S 20 University of Texas S a n J a c i n t o B MEDICAL MEDICAL SCHOOL SCHOOL l 7 10 CAPITOL CAPITOL EAST EAST CLARKSON HANCOCK 38½ St AIRPORT BLVD MLK Dell Seton Hospital MLK 2 COMAL Emma Long Metro Park LOOP 360 WHELESS EXPO EXPO COLONY PARK COLONY PARK TOWN CENTER 51st St 300 WESTMINSTER LOYOLA/ LOYOLA/ JOHNNY JOHNNY MORRIS MORRIS MLKMLK EXPO EXPO CENTER CENTER DECKER DECKER UT EAST LAFAYETTE 2 300 EAST US 183 130 TOLL RED BUD RED BUD GOV’T CENTER/ CAPITOL WEST 5TH/6TH & W LYNN 5TH/6TH & LAMAR CROSSTOWN CROSSTOWN CONGRESS AVE EXPOSITION Lake Austin Zilker Park S L a m a r B l Long Center LAMAR SQUARE TRINITY TRINITY Huston-Tillotson University WEBBERVILLE 4 REPUBLIC SQUARE CONV. CENTER/ BRUSH SQUARE RAINEY/ RAINEY/ MACC MACC Lady Bird Lake PLAZA SALTILLO PLAZA SALTILLO 17 Cesar Chavez St PLEASANT VALLEY PLEASANT VALLEY CESAR CHAVEZ WATERFRONT Riverside Dr Roy G. Guerrero CO Rive r Park LAKESHORE 17 311 ACC Riverside TRAVIS HEIGHTS LAKESHORE RIVERSIDE 20 SPRINGDALE CARTS EASTSIDE CARTS EASTSIDE BUS PLAZA BUS PLAZA AUDITORIUM SHORES 7 20 L L I I N N E E G G O O L L D D 10 SOCO SOCO S 1 s t S t S C o n g r e s s A v e OLTORF OLTORF 300 L L I I N N E E O O R R A A N N G G E E ST EDWARD’S ST EDWARD’S St Edward’s University 7 B u r t o n D r P a r k e r L n 7 B a G r e r t o e n n C b r e e lt e k BRODIE OAK OAK HILL HILL OLTORF WEST MENCHACA S La m ar Bl P a n t h e r T rl WESTGATE TRANSIT CENTER BRODIE OAKS WESTGATE B l v d W e s t G a t e T T O O B B U U R R N N E E T T M M E E N N C C H H A A C C A A ACC South Austin Stassney Ln STASSNEY Ben White Bl SOUTH CONGRESS SOUTH CONGRESS SOUTH CONGRESS TRANSIT CENTER TRANSIT CENTER TRANSIT CENTER 10 S 1 s t S t 311 333 OLTORF EAST P P L L E E A A S S A A N N T T V V A A L L L L E E Y Y TODD LN ST. ELMO M o n t o p o l i s D r 311 McKinney Falls State Park DOVE SPRINGS WILLIAM CANNON EAST FARO MONTOPOLIS METROCENTER METROCENTER (TEMPORARY NAME) BLUE LINE BLUE LINE AUS To Bastrop Bastrop Hwy Austin- Bergstrom International Airport 333 William Cannon Dr CHERRY CREEK WILLIAM CANNON 7 130 TOLL Map represents 15-percent design of program. WILDFLOWER TANGLEWOOD 10 SLAUGHTER TRANSIT CENTER Southpark Meadows GOODNIGHT To San Marcos MCKINNEY FALLS MCKINNEY FALLS Thaxton Rd 333 To Lockhart Barton Creek GreenbeltWalnut Creek Metro ParkEmma Long Metro ParkMcKinney Falls State ParkStoney CreekParkHuston-TillotsonUniversityHoward LnRundberg Ln51st StMLK BlSt Johns AveEnfield RdExposition Bl38½ StSan Jacinto BlN Lamar BlBurnet RdRiverside DrMontopolis DrBastrop HwyWest Gate BlvdBurton DrS Congress AveParker LnThaxton RdS Lamar BlS Lamar BlPanther TrlMetric BlBRAKER LNStassney LnS 1st StS 1st StCesar Chavez StACCSouth AustinSetonHospitalACCRiversideACCNorthridgeUniversityof TexasSt Edward’sUniversityLBJ High SchoolLongCenterZilkerParkRoy G. GuerreroCO River ParkLady Bird LakeAustin-BergstromInternationalAirportSouthparkMeadowsManor RdOak Springs DrLamar BlWilliam Cannon DrLake AustinMLK45TOLL130TOLL130TOLL130TOLL360LOOPDell SetonHospitalBen White BlDECKERMLKMLKUT EASTHANCOCKCLARKSONST. DAVID’SMEDICAL SCHOOLCAPITOLEASTTRINITYGOLD LINEGOLD LINEHIGHLANDSOCOST EDWARD’SSOUTH CONGRESSTRANSIT CENTERPLAZA SALTILLOCRESTVIEWMCKALLAKRAMERBROADMOOR/DOMAINHOWARDLEANDERMLKRED LINERED LINEHIGHLANDLAKELINEACC HIGHLAND TO TECH RIDGEACC HIGHLAND TO TECH RIDGEHIGHLANDTECH RIDGETRANSIT CENTERAUSMETROCENTERMONTOPOLISFAROLAKESHORETRAVISHEIGHTSWATERFRONTRAINEY/MACCBLUE LINEBLUE LINENORTH LAMARTRANSIT CENTERCRESTVIEWKOENIGTRIANGLEHYDEPARKHEMPHILL PARKUT/WEST MALLRIVERSIDEWILDHORSEMANORELGINCOLONY PARKPLAZA SALTILLOPLEASANT VALLEYSPRINGDALEGREEN LINEGREEN LINELOYOLA/JOHNNYMORRISBERKMAN/MUELLERAIRPORTBLVDACCEASTVIEWCESAR CHAVEZLAKESHOREOLTORF EASTTODD LNST. ELMODOVE SPRINGSWILLIAM CANNON EASTMCKINNEY FALLSGOODNIGHTPLEASANT VALLEYPLEASANT VALLEYGOVALLEPLEASANT VALLEYDELCO CENTERWHELESSSPRINGDALESHOPPING CENTERWESTMINSTERPHILOMENALAFAYETTEEXPO CENTERCOLONY PARK TOWN CENTERLOYOLA/JOHNNYMORRISEXPOEXPOCAPITOLEASTMEDICAL SCHOOLSOUTHENDRUTLANDCROSSROADSOHLENNORTHCROSSALLANDALENORTHLOOPTEXAS HEALTHCOMMISSIONLAMARSQUAREOLTORF WESTMENCHACABRODIEOAKSWESTGATELAMAR/WESTGATEBRODIECHERRY CREEKTANGLEWOODOAKHILLMENCHACA TO BURNETMENCHACA TO BURNET BURNET TO MENCHACA AND OAK HILL BURNET TO MENCHACA AND OAK HILL MCKALLABROADMOOR/DOMAINTRIANGLESLAUGHTERTRANSIT CENTERHEMPHILL PARKHYDEPARKKOENIGNORTH LAMARTRANSIT CENTERRUNDBERGBRAKERGOV’T CENTER/CAPITOL WESTSOCOOLTORFST EDWARD’SSOUTH CONGRESSTRANSIT CENTERSTASSNEYWILLIAM CANNONPARMERTRIANGLEUT/WEST MALLORANGE LINEORANGE LINECRESTVIEWTECH RIDGETRANSIT CENTERRED BUDEXPOSITION5TH/6TH& LAMARCOMALWEBBERVILLEGOVALLECARTS EASTSIDE BUS PLAZA5TH/6TH& W LYNNCROSSTOWNCROSSTOWNTRINITYPARMERPARMERLAKELINEWILDHORSE33330033333330030030033733577201010101077422171771032532532531131131172020337337To San MarcosTo LockhartTo BastropTo HuttoTo GeorgetownLOOP 360FOUR POINTSWILDFLOWERHOWARDLEANDERLAKELINEMANORELGINWILDHORSENORTH LAMARTRANSIT CENTERDELCO CENTEREXPO CENTERDECKERHIGHLANDTRIANGLEEASTUS 183CARTS EASTSIDE BUS PLAZARED BUDWESTGATETRANSIT CENTERSOUTH CONGRESSTRANSIT CENTERMCKINNEY FALLSOAKHILLMETROCENTER(TEMPORARY NAME)TECH RIDGETRANSIT CENTERCONV. CENTER/BRUSH SQUAREREPUBLICSQUAREAUDITORIUM SHORESCONGRESSAVERAINEY/MACCPflugervillePickup ZoneDessauPickup ZoneWalnut CreekPickup ZoneLeanderPickup ZoneManorPickup ZoneNE ATXPickup ZoneEast ATXPickup ZoneNorth Oak HillPickup ZoneSouth MenchacaPickup ZoneExpositionPickup ZoneSCHEMATIC MAPNOT TO SCALEBlue LineCurrent Frequent Local Routes2Red LineGreen LineEnhanced MetroRapid RoutePotential Future ExtensionPROPOSED PARK & RIDECURRENT PARK & RIDECIRCULATOR (PICKUP)APPROXIMATE ZONE LOCATIONCurrent MetroExpressFuture MetroExpressMETROBUSLIGHT RAILMETRORAILMETRORAPIDMETROEXPRESSMetroAccessPOTENTIAL TUNNEL LOCATIONTRANSFER POINTPotential Future ExtensionMetroBikeADDITIONAL AVAILABLE SERVICESOrange LinePotential Future ExtensionGold Line4 of 924 EXHIBIT B – Rail Construction Noise and Mitigation Plan Requirements The Austin Transit Partnership (ATP) will submit the required components listed below to be reviewed and approved by City Staff. City Staff will review the plan to ensure that all required components are present in the plan and are satisfactory to City Staff before approval. ATP commits to adhere and ensure that contracted parties responsible for light rail construction activities adhere to the policies and procedures housed within the submitted plans. The following components are required: 1. Construction Noise Mitigation and Monitoring Plan Construction noise impacts will be documented in the Final Environmental Impact Statement (FEIS), completed in compliance with the National Environmental Policy Act (NEPA) process. Mitigation measures identified in the Mitigation Monitoring Plan, affirmed in the FEIS and Record of Decision, will be included in contract documents, monitored for implementation during final design and construction. Measures to minimize impacts will include, but are not limited to: • • • Sound monitoring during construction Limiting idling and back up alarms of equipment Limiting certain activities during certain times 2. Noise Control Plan Requirements for Contractors during Construction ATP will require all contractors to submit a Noise Control Plan as part of their contract that addresses mitigation for their specific schedule, equipment, and methods of construction. ATP will submit their requirements of contractors for this plan to the City. The requirements will include, but are not limited to: Schedule (dates and times of day) and methods of construction • Contractor’s specific equipment types • • Maximum noise limits for each piece of equipment with certification testing • Prohibitions on certain types of equipment and processes during the night or daytime hours • • Methods for projecting construction noise levels • • Methods for responding to community complaints in line with the Programmatic Project Identification of specific sensitive locations near construction sites Implementation of noise control measures where appropriate Communications Plan. 3. Programmatic Project Communications Plan This plan will contain requirements for programmatic communications including how the program will communicate to the public about construction impacts and timelines, posting of public-facing materials, procedures for submission of noise and construction impact complaints, and how complaints will be handled. • This plan will be adhered to by all contractors for the program. This plan will dictate high-level requirements that ensure consistency of information, noticing, monitoring, reporting, and responding to complaints. Items that are required in this plan are: • 5 of 924 o Provisions for a Construction Noise webpage on the ProjectConnect.com website that will communicate: • construction plans and timelines, • notification of construction impacts, • what efforts are being made to minimize noise, • where noise complaints can be filed, • description of format of response to noise complaints and steps for corrective action to address verified complaints, links to documents mentioned in this policy and • • monitoring data. o Procedures for notifying surrounding residents and businesses of temporary construction impacts and providing complaint information o Procedures that detail how the public can submit noise complaints, how that information will be shared with the public, format of response and steps for corrective actions taken to address verified complaints. o Commitment to post noise monitoring information on at least a quarterly basis to the Project Connect Construction Noise webpage detailing noise readings and monitoring locations. 6 of 924 RESOLUTION NO. 20211029-003 WHEREAS, the Austin Strategic Mobility Plan ("ASMP") (Ordinance No. 20190411-033) is the transportation element of the Imagine Austin Comprehensive Plan and calls for a 50/50 mode share by 2039, which includes increasing use of sustainable modes such as walking, bicycling, teleworking and transit; WHEREAS, City Council adopted Resolution No. 20190808-081 directing the City Manager to "analyze and report on options for the City of Austin and other related or interested public or private entities to leverage resources to support the creation, operation, and maintenance of a high-capacity transit system"; WHEREAS, Austin voters approved Project Connect, the regional high- capacity transit system, on November 3,2020; WHEREAS, on December 18,2020, the City of Austin and the Capital Metropolitan Transportation Authority created a local government corporation named the Austin Transit Partnership Local Government Corporation to aid the City and Capital Metro and act on their behalf to accomplish the governmental purpose of implementing the Project Connect System Plan; WHEREAS, in a report entitled Saving Time and Making Cents: A Blueprintfor Building Transit Better ("Eno Report"), published in 2021, the Eno Center for Transportation identified local regulation, permitting, and decision- making procedures throughout the United States as an obstacle to achieving viable, cost-effective transit systems on par with those of peer nations; WHEREAS, noting that local development codes are generally ill- suited to the nature and scale of mass transit, the Eno Report found that jurisdictions that have successfully constructed mass transit systems apply modified regulations and review procedures to accommodate the unique challenges Page 1 0f 3 7 of 924 transit construction presents and the ways it differs from private development or conventional transportation and public works projects; WHEREAS, the City ofAustin's Land Development Code does not provide for the design and permitting of linear construction required for mobility and transit facilities that encompass large areas, include subsurface and above-ground elements, and span multiple zoning districts and watersheds; WHEREAS, greater flexibility and more carefully tailored regulations are required to facilitate construction of Project Connect; WHEREAS, City staff routinely interprets and applies City Code to development and capital improvement applications; WHEREAS, the Land Development Code, existing regulations, criteria, and procedures should be flexibly applied to facilitate construction of Project Connect to the greatest extent possible until existing requirements can be amended; WHEREAS, there are Project Connect MetroRapid and MetroRail projects currently moving forward in advance of the Orange and Blue Line light rail projects; and WHEREAS, motor vehicle trip conversion to high-capacity transit and other sustainable modes yields benefits to the environment; NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF AUSTIN: 1. The City Council directs the City Manager to: a. Review City Code, including, but not limited to, the Land Development Code, Criteria Manuals, and permitting procedures to identify Page 2 of 3 8 of 924 impediments to the design, construction, implementation, and operation of Project Connect; b. Develop new regulations and procedures to address the impediments and assure implementation and construction of Project Connect consistent with the sequence plan approved in the Contract with Voters in a manner cognizant of other City policies, including commitments in the Project Connect Joint Powers Agreement and consistent with environmental protections in various adopted plans, including but not limited to those that identify the range of environmental benefits that can be achieved by reducing single occupancy motor vehicle trips; c. Present any Code amendments necessary to accomplish the goals of Paragraphs 1.a and 1.b to City Council no later than April 2022; and d. After Council adoption of Code amendments, follow appropriate procedures to issue any rules necessary to implement the Code amendments; BE T F JRTHER RESOLVED: Until City Council adopts new or amended Code provisions, the City Council directs the City Manager to interpret and apply existing requirements to Project Connect permits and approvals in a manner that considers the framework established by the Contract with the Voters, and other applicable City policies while working to support implementation of Project Connect. /1 Ijl V- ADOPTED: October 29 , 2021 ATTEST: 0,4t),Et ?<- JaAette S. Goodall City Clerk Page 3 0f 3 9 of 924